BLASTX 7.6.2 Query= RU11177 /QuerySize=257 (256 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157335798|emb|CAO61628.1| unnamed protein product [Vitis vini... 53 5e-006 >gi|157335798|emb|CAO61628.1| unnamed protein product [Vitis vinifera] Length = 138 Score = 53 bits (126), Expect = 5e-006 Identities = 25/47 (53%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = +3 Query: 114 MWDEWGDPSFSNTDEQQQHTDQDSHLNFDFFSELSKPKDYYKILEVD 254 MWD+W + + + Q+ DS LNFDF S LSKPKDYY +LEVD Sbjct: 2 MWDDWNNWD-DDVSQPQEEPPPDSPLNFDFLSLLSKPKDYYGMLEVD 47 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 301,939,573,105 Number of Sequences: 7387702 Number of Extensions: 301939573105 Number of Successful Extensions: 164633019 Number of sequences better than 0.0: 0 |