BLASTX 7.6.2 Query= RU11516 /QuerySize=237 (236 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|115480265|ref|NP_001063726.1| Os09g0526600 [Oryza sativa (jap... 67 3e-010 gi|52077317|dbj|BAD46358.1| putative heat shock factor [Oryza sa... 67 3e-010 gi|125564440|gb|EAZ09820.1| hypothetical protein OsI_031052 [Ory... 67 3e-010 gi|110430653|gb|ABG73443.1| heat shock factor [Oryza brachyantha] 66 8e-010 gi|195655741|gb|ACG47338.1| unknown [Zea mays] 66 8e-010 >gi|115480265|ref|NP_001063726.1| Os09g0526600 [Oryza sativa (japonica cultivar-group)] Length = 454 Score = 67 bits (162), Expect = 3e-010 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 115 RKSSPPPFLLKTYMLVEDPATDDVISWNEDGSAFVVWQ 2 ++S P PFL KTY LVEDPA DDVISWNEDGS FVVW+ Sbjct: 32 QRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWR 69 >gi|52077317|dbj|BAD46358.1| putative heat shock factor [Oryza sativa Japonica Group] Length = 414 Score = 67 bits (162), Expect = 3e-010 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 115 RKSSPPPFLLKTYMLVEDPATDDVISWNEDGSAFVVWQ 2 ++S P PFL KTY LVEDPA DDVISWNEDGS FVVW+ Sbjct: 32 QRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWR 69 >gi|125564440|gb|EAZ09820.1| hypothetical protein OsI_031052 [Oryza sativa (indica cultivar-group)] Length = 446 Score = 67 bits (162), Expect = 3e-010 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -2 Query: 115 RKSSPPPFLLKTYMLVEDPATDDVISWNEDGSAFVVWQ 2 ++S P PFL KTY LVEDPA DDVISWNEDGS FVVW+ Sbjct: 32 QRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWR 69 >gi|110430653|gb|ABG73443.1| heat shock factor [Oryza brachyantha] Length = 408 Score = 66 bits (159), Expect = 8e-010 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 115 RKSSPPPFLLKTYMLVEDPATDDVISWNEDGSAFVVWQ 2 ++S P PFL KTY LV+DPA DDVISWNEDGS FVVW+ Sbjct: 31 QRSLPTPFLTKTYQLVDDPAVDDVISWNEDGSTFVVWR 68 >gi|195655741|gb|ACG47338.1| unknown [Zea mays] Length = 377 Score = 66 bits (159), Expect = 8e-010 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 115 RKSSPPPFLLKTYMLVEDPATDDVISWNEDGSAFVVWQ 2 ++S P PFL KTY LV+DPA DDVISWN+DGSAF+VW+ Sbjct: 30 QRSVPTPFLTKTYQLVDDPAVDDVISWNDDGSAFIVWR 67 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 301,939,573,105 Number of Sequences: 7387702 Number of Extensions: 301939573105 Number of Successful Extensions: 164633019 Number of sequences better than 0.0: 0 |