BLASTX 7.6.2 Query= RU11520 /QuerySize=237 (236 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147864402|emb|CAN80502.1| hypothetical protein [Vitis vinifera] 67 3e-010 gi|157340421|emb|CAO47226.1| unnamed protein product [Vitis vini... 67 3e-010 gi|18399675|ref|NP_565510.1| kinesin motor protein-related [Arab... 54 3e-006 >gi|147864402|emb|CAN80502.1| hypothetical protein [Vitis vinifera] Length = 1082 Score = 67 bits (162), Expect = 3e-010 Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +1 Query: 109 ASSSRARSSSPFSYRKPSSPYSSTSSSSSLINGRALIPRSCS 234 ASSSR RSSSPF YRKPSSPYSS+SSSSS +NG+ L+PRSCS Sbjct: 3 ASSSRGRSSSPFHYRKPSSPYSSSSSSSSFMNGK-LMPRSCS 43 >gi|157340421|emb|CAO47226.1| unnamed protein product [Vitis vinifera] Length = 1056 Score = 67 bits (162), Expect = 3e-010 Identities = 34/42 (80%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +1 Query: 109 ASSSRARSSSPFSYRKPSSPYSSTSSSSSLINGRALIPRSCS 234 ASSSR RSSSPF YRKPSSPYSS+SSSSS +NG+ L+PRSCS Sbjct: 3 ASSSRGRSSSPFHYRKPSSPYSSSSSSSSFMNGK-LMPRSCS 43 >gi|18399675|ref|NP_565510.1| kinesin motor protein-related [Arabidopsis thaliana] Length = 1058 Score = 54 bits (128), Expect = 3e-006 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +1 Query: 109 ASSSRARSSSPFSYRKPSSPYSSTSS-SSSLINGRALIPRSCS 234 +SSSR RS SPFS+R+P SPYSS SS SSSLIN R L+PRS S Sbjct: 3 SSSSRTRSRSPFSHRRPPSPYSSASSTSSSLINNR-LLPRSSS 44 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 301,939,573,105 Number of Sequences: 7387702 Number of Extensions: 301939573105 Number of Successful Extensions: 164633019 Number of sequences better than 0.0: 0 |