BLASTX 7.6.2 Query= RU12852 /QuerySize=632 (631 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157355495|emb|CAO48885.1| unnamed protein product [Vitis vini... 76 2e-012 >gi|157355495|emb|CAO48885.1| unnamed protein product [Vitis vinifera] Length = 120 Score = 76 bits (185), Expect = 2e-012 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = +2 Query: 413 MVLSKLPDSSKTRKCNPVQTQLLFPMGQMDAVVSDHVELDFSDVFGPVPVHAPVDS 580 MV S +P +KTR C P+Q QLLFPM D V DHVELDF+DVFGP+PV P D+ Sbjct: 1 MVFSDVPGLTKTRMCKPIQNQLLFPMNPTDIVPLDHVELDFADVFGPLPVQTPTDT 56 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 340,404,849,014 Number of Sequences: 7387702 Number of Extensions: 340404849014 Number of Successful Extensions: 174486074 Number of sequences better than 0.0: 0 |