BLASTX 7.6.2 Query= RU13672 /QuerySize=184 (183 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147865022|emb|CAN78971.1| hypothetical protein [Vitis vinifera] 56 7e-007 gi|157336408|emb|CAO71093.1| unnamed protein product [Vitis vini... 56 7e-007 >gi|147865022|emb|CAN78971.1| hypothetical protein [Vitis vinifera] Length = 215 Score = 56 bits (134), Expect = 7e-007 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 4/47 (8%) Frame = -3 Query: 136 MNPSLSSS----SSPPSSTSASAGSWFSGVVRGRSDRAGSVKMGSDS 8 MN S SSS SS PSS+S+S SWFSG+VRGRSD++GS+KM ++S Sbjct: 1 MNLSASSSSSLLSSSPSSSSSSTTSWFSGIVRGRSDKSGSIKMANNS 47 >gi|157336408|emb|CAO71093.1| unnamed protein product [Vitis vinifera] Length = 347 Score = 56 bits (134), Expect = 7e-007 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 4/47 (8%) Frame = -3 Query: 136 MNPSLSSS----SSPPSSTSASAGSWFSGVVRGRSDRAGSVKMGSDS 8 MN S SSS SS PSS+S+S SWFSG+VRGRSD++GS+KM ++S Sbjct: 1 MNLSASSSSSLLSSSPSSSSSSTTSWFSGIVRGRSDKSGSIKMANNS 47 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 340,404,849,014 Number of Sequences: 7387702 Number of Extensions: 340404849014 Number of Successful Extensions: 174486074 Number of sequences better than 0.0: 0 |