BLASTX 7.6.2 Query= RU13742 /QuerySize=246 (245 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157355145|emb|CAO48521.1| unnamed protein product [Vitis vini... 135 1e-030 gi|157349919|emb|CAO39775.1| unnamed protein product [Vitis vini... 109 8e-023 gi|30696333|ref|NP_200155.2| SDG29 (SET DOMAIN GROUP 29); DNA bi... 109 1e-022 gi|42567196|ref|NP_194520.3| PHD finger protein-related / SET do... 102 1e-020 gi|110742931|dbj|BAE99361.1| trithorax 3 [Arabidopsis thaliana] 78 2e-013 >gi|157355145|emb|CAO48521.1| unnamed protein product [Vitis vinifera] Length = 1041 Score = 135 bits (338), Expect = 1e-030 Identities = 59/79 (74%), Positives = 67/79 (84%), Gaps = 2/79 (2%) Frame = -1 Query: 242 DSGTWVRCDGCRVWVHAECDRINTNYYKNLGGTDYFCPPCKVKFNFELSDSEKEQPKVKC 63 DSGTWVRCDGC+VWVHAEC +I++ +KNLG TDY+CP CK KFNFELSDSE+ QPKVKC Sbjct: 425 DSGTWVRCDGCKVWVHAECGKISSKLFKNLGATDYYCPACKAKFNFELSDSERWQPKVKC 484 Query: 62 RSTKNEAQLVLPNKVTVLC 6 KN +QLVLPNKVTV C Sbjct: 485 --NKNNSQLVLPNKVTVTC 501 >gi|157349919|emb|CAO39775.1| unnamed protein product [Vitis vinifera] Length = 1038 Score = 109 bits (271), Expect = 8e-023 Identities = 48/79 (60%), Positives = 58/79 (73%), Gaps = 2/79 (2%) Frame = -1 Query: 242 DSGTWVRCDGCRVWVHAECDRINTNYYKNLGGTDYFCPPCKVKFNFELSDSEKEQPKVKC 63 D G WV CDGC VWVHAEC++I+T K+L DY+CP CK KFNFELSDS+K QPKVKC Sbjct: 434 DGGNWVCCDGCNVWVHAECEKISTKRLKDLEDIDYYCPDCKAKFNFELSDSDKWQPKVKC 493 Query: 62 RSTKNEAQLVLPNKVTVLC 6 +N VLP+K+ V+C Sbjct: 494 --IENNGPPVLPDKLAVVC 510 >gi|30696333|ref|NP_200155.2| SDG29 (SET DOMAIN GROUP 29); DNA binding [Arabidopsis thaliana] Length = 1043 Score = 109 bits (270), Expect = 1e-022 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 2/79 (2%) Frame = -1 Query: 242 DSGTWVRCDGCRVWVHAECDRINTNYYKNLGGTDYFCPPCKVKFNFELSDSEKEQPKVKC 63 DS +WVRCDGC+VW+H+ CD+I+ ++K+LG TDY+CP C+ KF+FELSDSEK P K Sbjct: 427 DSQSWVRCDGCKVWIHSACDQISHKHFKDLGETDYYCPTCRTKFDFELSDSEK--PDSKS 484 Query: 62 RSTKNEAQLVLPNKVTVLC 6 + KN A +VLP+KV V+C Sbjct: 485 KLGKNNAPMVLPDKVIVVC 503 >gi|42567196|ref|NP_194520.3| PHD finger protein-related / SET domain-containing protein (TX4) [Arabidopsis thaliana] Length = 1027 Score = 102 bits (253), Expect = 1e-020 Identities = 44/79 (55%), Positives = 60/79 (75%), Gaps = 2/79 (2%) Frame = -1 Query: 242 DSGTWVRCDGCRVWVHAECDRINTNYYKNLGGTDYFCPPCKVKFNFELSDSEKEQPKVKC 63 D+ +WVRCDGC+V +HAECD+I+ + K+L TDY+CP C+ KFNF+LSDSEK+ K K Sbjct: 412 DNKSWVRCDGCKVRIHAECDQISDRHLKDLRETDYYCPTCRAKFNFDLSDSEKQNSKSKV 471 Query: 62 RSTKNEAQLVLPNKVTVLC 6 K + Q+VLP+KV V+C Sbjct: 472 --AKGDGQMVLPDKVIVVC 488 >gi|110742931|dbj|BAE99361.1| trithorax 3 [Arabidopsis thaliana] Length = 1018 Score = 78 bits (190), Expect = 2e-013 Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 2/79 (2%) Frame = -1 Query: 242 DSGTWVRCDGCRVWVHAECDRINTNYYKNLGGTDYFCPPCKVKFNFELSDSEKEQPKVKC 63 D G WV CDGC VWVHAECD I +K L +Y+CP CKV+ EL+ + E+ Sbjct: 376 DDGDWVCCDGCDVWVHAECDNITNERFKELEHNNYYCPDCKVQ--HELTPTILEEQNSVF 433 Query: 62 RSTKNEAQLVLPNKVTVLC 6 +ST+ + LP+ +TV+C Sbjct: 434 KSTEKTTETGLPDAITVVC 452 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 340,404,849,014 Number of Sequences: 7387702 Number of Extensions: 340404849014 Number of Successful Extensions: 174486074 Number of sequences better than 0.0: 0 |