BLASTX 7.6.2 Query= RU14343 /QuerySize=169 (168 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|118488246|gb|ABK95942.1| unknown [Populus trichocarpa] 103 5e-021 gi|22651698|gb|AAM48290.1| homeodomain protein Hfi22 [Nicotiana ... 99 7e-020 gi|18399966|ref|NP_565536.1| ATHB6 (ARABIDOPSIS THALIANA HOMEOBO... 99 9e-020 gi|5305602|gb|AAD41726.1| homeobox protein ATHB6 [Arabidopsis th... 99 9e-020 gi|8133126|gb|AAF73482.1|AF268422_1 hb-6-like protein [Brassica ... 99 9e-020 >gi|118488246|gb|ABK95942.1| unknown [Populus trichocarpa] Length = 328 Score = 103 bits (256), Expect = 5e-021 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +3 Query: 3 ERKVKLAAELGLEPRQVAIWFQNRRARWKTKQLERDYSVLKADYDSLKHNYDGL 164 ERKVKLA ELGL+PRQVA+WFQNRRARWKTKQLERDY VLKA+YDSLKHN+D L Sbjct: 85 ERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDSLKHNFDAL 138 >gi|22651698|gb|AAM48290.1| homeodomain protein Hfi22 [Nicotiana tabacum] Length = 308 Score = 99 bits (246), Expect = 7e-020 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = +3 Query: 3 ERKVKLAAELGLEPRQVAIWFQNRRARWKTKQLERDYSVLKADYDSLKHNYDGL 164 ERKVKLA ELGL+PRQVA+WFQNRRARWKTKQLERDY VLK+++D+LKHNY+ L Sbjct: 44 ERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKSNFDALKHNYESL 97 >gi|18399966|ref|NP_565536.1| ATHB6 (ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 6); transcription factor [Arabidopsis thaliana] Length = 311 Score = 99 bits (245), Expect = 9e-020 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 3 ERKVKLAAELGLEPRQVAIWFQNRRARWKTKQLERDYSVLKADYDSLKHNYDGL 164 ERKVKLA ELGL+PRQVA+WFQNRRARWKTKQLE+DY VLK YDSL+HN+D L Sbjct: 87 ERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSL 140 >gi|5305602|gb|AAD41726.1| homeobox protein ATHB6 [Arabidopsis thaliana] Length = 291 Score = 99 bits (245), Expect = 9e-020 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 3 ERKVKLAAELGLEPRQVAIWFQNRRARWKTKQLERDYSVLKADYDSLKHNYDGL 164 ERKVKLA ELGL+PRQVA+WFQNRRARWKTKQLE+DY VLK YDSL+HN+D L Sbjct: 87 ERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSL 140 >gi|8133126|gb|AAF73482.1|AF268422_1 hb-6-like protein [Brassica rapa subsp. pekinensis] Length = 310 Score = 99 bits (245), Expect = 9e-020 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 3 ERKVKLAAELGLEPRQVAIWFQNRRARWKTKQLERDYSVLKADYDSLKHNYDGL 164 ERKVKLA ELGL+PRQVA+WFQNRRARWKTKQLE+DY VLK YDSL+HN+D L Sbjct: 87 ERKVKLALELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSL 140 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 340,404,849,014 Number of Sequences: 7387702 Number of Extensions: 340404849014 Number of Successful Extensions: 174486074 Number of sequences better than 0.0: 0 |