BLASTX 7.6.2 Query= RU15468 /QuerySize=265 (264 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157349819|emb|CAO39675.1| unnamed protein product [Vitis vini... 82 1e-014 gi|15222553|ref|NP_176569.1| zinc finger (C3HC4-type RING finger... 74 3e-012 gi|15233117|ref|NP_191705.1| BRH1 (BRASSINOSTEROID-RESPONSIVE RI... 74 3e-012 gi|21554155|gb|AAM63234.1| RING zinc finger protein-like [Arabid... 68 2e-010 gi|15238072|ref|NP_198956.1| zinc finger (C3HC4-type RING finger... 68 2e-010 >gi|157349819|emb|CAO39675.1| unnamed protein product [Vitis vinifera] Length = 167 Score = 82 bits (201), Expect = 1e-014 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -3 Query: 178 MGFPAGYTELLLPKLFLSTLSLLGFIRKLITTLFSLLGLQDFIETDNAWSDPAPTPPGY 2 MGFP GYTE+ LPKLFL TLS LGFIRKLI +LF LGL DF+ETD +WS+ P Y Sbjct: 1 MGFPVGYTEVFLPKLFLHTLSFLGFIRKLIFSLFHFLGLSDFLETDVSWSETQAQVPEY 59 >gi|15222553|ref|NP_176569.1| zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana] Length = 166 Score = 74 bits (180), Expect = 3e-012 Identities = 34/58 (58%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = -3 Query: 178 MGFPAGYTELLLPKLFLSTLSLLGFIRKLITTLFSLLGLQDFIETD---NAWSDPAPT 14 MGFP GY+ELLLPK+F LS LG IRKLI+T+F ++GL DF+E + +W DP PT Sbjct: 1 MGFPVGYSELLLPKIFFYLLSFLGLIRKLISTMFKIIGLPDFLEPEPVSTSWPDPPPT 58 >gi|15233117|ref|NP_191705.1| BRH1 (BRASSINOSTEROID-RESPONSIVE RING-H2); protein binding / zinc ion binding [Arabidopsis thaliana] Length = 170 Score = 74 bits (180), Expect = 3e-012 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = -3 Query: 178 MGFPAGYTELLLPKLFLSTLSLLGFIRKLITTLFSLLGLQDFIETDNAWSDPAPTP 11 MGFP GYTE+ LPKLF+ TLS+LGFIR ++ ++F LGL DF+E D W D P Sbjct: 1 MGFPVGYTEVFLPKLFVQTLSILGFIRTIVFSIFRFLGLSDFLEMDQTWPDYTSYP 56 >gi|21554155|gb|AAM63234.1| RING zinc finger protein-like [Arabidopsis thaliana] Length = 176 Score = 68 bits (165), Expect = 2e-010 Identities = 34/59 (57%), Positives = 41/59 (69%) Frame = -3 Query: 178 MGFPAGYTELLLPKLFLSTLSLLGFIRKLITTLFSLLGLQDFIETDNAWSDPAPTPPGY 2 MG+P GYTELLLP++FL LSLLG IR LI T F +LGL DF+E+D S + P Y Sbjct: 1 MGYPVGYTELLLPRIFLHLLSLLGLIRTLIDTGFRILGLPDFLESDPVLSSSSWLEPPY 59 >gi|15238072|ref|NP_198956.1| zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana] Length = 176 Score = 68 bits (164), Expect = 2e-010 Identities = 34/59 (57%), Positives = 41/59 (69%) Frame = -3 Query: 178 MGFPAGYTELLLPKLFLSTLSLLGFIRKLITTLFSLLGLQDFIETDNAWSDPAPTPPGY 2 MG+P GYTELLLP++FL LSLLG IR LI T F +LGL DF+E+D S + P Y Sbjct: 1 MGYPVGYTELLLPRIFLHLLSLLGLIRTLIDTGFRILGLPDFLESDPVSSSSSWLEPPY 59 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 353,252,282,926 Number of Sequences: 7387702 Number of Extensions: 353252282926 Number of Successful Extensions: 191236155 Number of sequences better than 0.0: 0 |