BLASTX 7.6.2 Query= RU16500 /QuerySize=213 (212 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147811306|emb|CAN76715.1| hypothetical protein [Vitis vinifera] 101 2e-020 gi|157337855|emb|CAO38899.1| unnamed protein product [Vitis vini... 94 3e-018 gi|18416821|ref|NP_567757.1| AR192; adenyl-nucleotide exchange f... 93 5e-018 gi|1669597|dbj|BAA13686.1| AR192 [Arabidopsis thaliana] 93 5e-018 gi|4455201|emb|CAB36524.1| grpE like protein [Arabidopsis thaliana] 93 5e-018 >gi|147811306|emb|CAN76715.1| hypothetical protein [Vitis vinifera] Length = 413 Score = 101 bits (250), Expect = 2e-020 Identities = 53/70 (75%), Positives = 60/70 (85%), Gaps = 6/70 (8%) Frame = +3 Query: 3 KRTAFSDSDSDSDSDSDGDLSTEDLVKLLTEKEELLKQKHKEIEKMQDKVLRSYAEMENV 182 KRTAFSDSDS++ DLS +DL+KL+ EKEELLK K+KEIEKMQDKVLRSYAEMENV Sbjct: 216 KRTAFSDSDSEA------DLSMDDLMKLVVEKEELLKMKNKEIEKMQDKVLRSYAEMENV 269 Query: 183 MDRTRREAEN 212 M+R RREAEN Sbjct: 270 MERARREAEN 279 >gi|157337855|emb|CAO38899.1| unnamed protein product [Vitis vinifera] Length = 298 Score = 94 bits (232), Expect = 3e-018 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +3 Query: 39 DSDSDGDLSTEDLVKLLTEKEELLKQKHKEIEKMQDKVLRSYAEMENVMDRTRREAEN 212 +SDS+ DLS +DL+KL+ EKEELLK K+KEIEKMQDKVLRSYAEMENVM+R RREAEN Sbjct: 107 ESDSEADLSMDDLMKLVLEKEELLKMKNKEIEKMQDKVLRSYAEMENVMERARREAEN 164 >gi|18416821|ref|NP_567757.1| AR192; adenyl-nucleotide exchange factor/ chaperone binding / protein binding / protein homodimerization [Arabidopsis thaliana] Length = 327 Score = 93 bits (230), Expect = 5e-018 Identities = 47/70 (67%), Positives = 60/70 (85%), Gaps = 1/70 (1%) Frame = +3 Query: 3 KRTAFSDSDSDSDSDSDGDLSTEDLVKLLTEKEELLKQKHKEIEKMQDKVLRSYAEMENV 182 K A S S+SDS+SD D +LS +DLVKL+ EKEELL +K +EI++++DKVLR+YAEMENV Sbjct: 121 KGAASSSSESDSESDDD-ELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENV 179 Query: 183 MDRTRREAEN 212 MDRTRR+AEN Sbjct: 180 MDRTRRDAEN 189 >gi|1669597|dbj|BAA13686.1| AR192 [Arabidopsis thaliana] Length = 273 Score = 93 bits (230), Expect = 5e-018 Identities = 47/70 (67%), Positives = 60/70 (85%), Gaps = 1/70 (1%) Frame = +3 Query: 3 KRTAFSDSDSDSDSDSDGDLSTEDLVKLLTEKEELLKQKHKEIEKMQDKVLRSYAEMENV 182 K A S S+SDS+SD D +LS +DLVKL+ EKEELL +K +EI++++DKVLR+YAEMENV Sbjct: 68 KGAASSSSESDSESDDD-ELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENV 126 Query: 183 MDRTRREAEN 212 MDRTRR+AEN Sbjct: 127 MDRTRRDAEN 136 >gi|4455201|emb|CAB36524.1| grpE like protein [Arabidopsis thaliana] Length = 311 Score = 93 bits (230), Expect = 5e-018 Identities = 47/70 (67%), Positives = 60/70 (85%), Gaps = 1/70 (1%) Frame = +3 Query: 3 KRTAFSDSDSDSDSDSDGDLSTEDLVKLLTEKEELLKQKHKEIEKMQDKVLRSYAEMENV 182 K A S S+SDS+SD D +LS +DLVKL+ EKEELL +K +EI++++DKVLR+YAEMENV Sbjct: 105 KGAASSSSESDSESDDD-ELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENV 163 Query: 183 MDRTRREAEN 212 MDRTRR+AEN Sbjct: 164 MDRTRRDAEN 173 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 397,919,240,014 Number of Sequences: 7387702 Number of Extensions: 397919240014 Number of Successful Extensions: 209897449 Number of sequences better than 0.0: 0 |