BLASTX 7.6.2 Query= RU16694 /QuerySize=199 (198 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|163955690|gb|ABY49843.1| 24-sterol C-methyltransferase [Gossy... 77 5e-013 gi|118482368|gb|ABK93107.1| unknown [Populus trichocarpa] 74 2e-012 gi|118485678|gb|ABK94689.1| unknown [Populus trichocarpa] 71 2e-011 gi|147811090|emb|CAN67923.1| hypothetical protein [Vitis vinifera] 70 4e-011 gi|157336145|emb|CAO61975.1| unnamed protein product [Vitis vini... 70 4e-011 >gi|163955690|gb|ABY49843.1| 24-sterol C-methyltransferase [Gossypium hirsutum] Length = 361 Score = 77 bits (187), Expect = 5e-013 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 81 MESLTLFCTGALLAGGLYWFVCVLGPAERQGKRAADLSG 197 M+SL+LFCTGALLAGGLYWFVCVLGPAE++GKRA DLSG Sbjct: 1 MDSLSLFCTGALLAGGLYWFVCVLGPAEQKGKRAVDLSG 39 >gi|118482368|gb|ABK93107.1| unknown [Populus trichocarpa] Length = 364 Score = 74 bits (181), Expect = 2e-012 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 81 MESLTLFCTGALLAGGLYWFVCVLGPAERQGKRAADLSG 197 M+SL LFCTGAL+AGG+YWFVC+LGPAE++GKRA DLSG Sbjct: 1 MDSLALFCTGALIAGGIYWFVCILGPAEQKGKRAVDLSG 39 >gi|118485678|gb|ABK94689.1| unknown [Populus trichocarpa] Length = 364 Score = 71 bits (173), Expect = 2e-011 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 81 MESLTLFCTGALLAGGLYWFVCVLGPAERQGKRAADLSG 197 M+SL LF TGALLAGG+YWFVCVLGPAE++GKRA DLSG Sbjct: 1 MDSLALFFTGALLAGGIYWFVCVLGPAEQKGKRAVDLSG 39 >gi|147811090|emb|CAN67923.1| hypothetical protein [Vitis vinifera] Length = 360 Score = 70 bits (170), Expect = 4e-011 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +3 Query: 81 MESLTLFCTGALLAGGLYWFVCVLGPAERQGKRAADLSG 197 M+SLTLFCT ALLAGGLYWFVC+LG AE+ GKR DLSG Sbjct: 1 MDSLTLFCTAALLAGGLYWFVCILGSAEQTGKRGVDLSG 39 >gi|157336145|emb|CAO61975.1| unnamed protein product [Vitis vinifera] Length = 360 Score = 70 bits (170), Expect = 4e-011 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +3 Query: 81 MESLTLFCTGALLAGGLYWFVCVLGPAERQGKRAADLSG 197 M+SLTLFCT ALLAGGLYWFVC+LG AE+ GKR DLSG Sbjct: 1 MDSLTLFCTAALLAGGLYWFVCILGSAEQTGKRGVDLSG 39 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 397,919,240,014 Number of Sequences: 7387702 Number of Extensions: 397919240014 Number of Successful Extensions: 209897449 Number of sequences better than 0.0: 0 |