BLASTX 7.6.2 Query= RU17333 /QuerySize=257 (256 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147852500|emb|CAN78519.1| hypothetical protein [Vitis vinifera] 56 6e-007 gi|4753657|emb|CAB41933.1| putative protein [Arabidopsis thaliana] 55 1e-006 gi|18413957|ref|NP_567398.1| late embryogenesis abundant domain-... 55 1e-006 >gi|147852500|emb|CAN78519.1| hypothetical protein [Vitis vinifera] Length = 145 Score = 56 bits (134), Expect = 6e-007 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 7/48 (14%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AKQTVQ AWGS K+T V GK +E+KE VK+NAE VK++MNTK Sbjct: 104 AKQTVQGAWGSVKET-------VAGKTEEAKECVKDNAETVKRNMNTK 144 >gi|4753657|emb|CAB41933.1| putative protein [Arabidopsis thaliana] Length = 158 Score = 55 bits (132), Expect = 1e-006 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AK T ++AW KDT +K D V GK +E+KE +K A+ V++SMNTK Sbjct: 108 AKNTAEEAWDKVKDTTEKIKDTVTGKTEETKESIKATAKTVERSMNTK 155 >gi|18413957|ref|NP_567398.1| late embryogenesis abundant domain-containing protein / LEA domain-containing protein [Arabidopsis thaliana] Length = 120 Score = 55 bits (132), Expect = 1e-006 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AK T ++AW KDT +K D V GK +E+KE +K A+ V++SMNTK Sbjct: 70 AKNTAEEAWDKVKDTTEKIKDTVTGKTEETKESIKATAKTVERSMNTK 117 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 397,919,240,014 Number of Sequences: 7387702 Number of Extensions: 397919240014 Number of Successful Extensions: 209897449 Number of sequences better than 0.0: 0 |