BLASTX 7.6.2 Query= RU17609 /QuerySize=311 (310 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|62956018|gb|AAY23354.1| 3-ketoacyl-CoA reductase 1 [Gossypium... 87 2e-016 gi|157339108|emb|CAO42459.1| unnamed protein product [Vitis vini... 80 5e-014 gi|28565601|gb|AAO43449.1| putative 3-ketoacyl-CoA reductase 2 [... 77 2e-013 gi|28565597|gb|AAO43448.1| putative 3-ketoacyl-CoA reductase 1 [... 77 4e-013 gi|18408847|ref|NP_564905.1| YBR159; ketoreductase/ oxidoreducta... 70 5e-011 >gi|62956018|gb|AAY23354.1| 3-ketoacyl-CoA reductase 1 [Gossypium hirsutum] Length = 320 Score = 87 bits (215), Expect = 2e-016 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +3 Query: 126 MDCFILGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 M+ LK QP+WV+ LF++GSLS+L+FS L WV++NFLRP KNLKKYGSW LVTG Sbjct: 1 MEACFFDTLKAQPFWVIFLFTLGSLSLLKFSFVFLKWVWINFLRPGKNLKKYGSWGLVTG 60 Query: 306 P 308 P Sbjct: 61 P 61 >gi|157339108|emb|CAO42459.1| unnamed protein product [Vitis vinifera] Length = 320 Score = 80 bits (195), Expect = 5e-014 Identities = 35/61 (57%), Positives = 48/61 (78%) Frame = +3 Query: 126 MDCFILGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 M+ + +L+TQP WV+ LF++G LS+L+ +++LN V+V FLRP KNLKKYGSWALVT Sbjct: 1 MELCFMEKLQTQPLWVIVLFAVGCLSVLKSFLAILNGVYVCFLRPGKNLKKYGSWALVTA 60 Query: 306 P 308 P Sbjct: 61 P 61 >gi|28565601|gb|AAO43449.1| putative 3-ketoacyl-CoA reductase 2 [Brassica napus] Length = 319 Score = 77 bits (189), Expect = 2e-013 Identities = 31/52 (59%), Positives = 46/52 (88%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LFS+GS+SILRF++++L +++ FLRP KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLVLFSLGSISILRFTLTLLTSLYIYFLRPGKNLRRYGSWAIITGP 59 >gi|28565597|gb|AAO43448.1| putative 3-ketoacyl-CoA reductase 1 [Brassica napus] Length = 319 Score = 77 bits (187), Expect = 4e-013 Identities = 31/52 (59%), Positives = 45/52 (86%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LFS+GS+SILRF+ ++L +++ FLRP KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLVLFSLGSISILRFTFTLLTSLYIYFLRPGKNLRRYGSWAIITGP 59 >gi|18408847|ref|NP_564905.1| YBR159; ketoreductase/ oxidoreductase [Arabidopsis thaliana] Length = 318 Score = 70 bits (169), Expect = 5e-011 Identities = 28/52 (53%), Positives = 42/52 (80%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LF +GS+SI +F ++L ++ FLRP+KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITGP 59 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 397,919,240,014 Number of Sequences: 7387702 Number of Extensions: 397919240014 Number of Successful Extensions: 209897449 Number of sequences better than 0.0: 0 |