BLASTX 7.6.2 Query= RU18493 /QuerySize=238 (237 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|66805125|ref|XP_636295.1| hypothetical protein [Dictyostelium... 53 7e-006 gi|110762942|ref|XP_001122760.1| PREDICTED: hypothetical protein... 52 9e-006 >gi|66805125|ref|XP_636295.1| hypothetical protein [Dictyostelium discoideum AX4] Length = 915 Score = 53 bits (125), Expect = 7e-006 Identities = 28/61 (45%), Positives = 32/61 (52%) Frame = +2 Query: 23 QASSKLNEFEHQSGNNVGLGVQGIGAQQQQQQHQHQHQLQPQHQLQPQSQLQPPQQHQQL 202 Q + + +HQ L +Q QQQQQQHQHQHQ Q QHQ Q Q Q Q QH Sbjct: 394 QQQQQQQQHQHQQQQQQLLQLQQQQQQQQQQQHQHQHQHQHQHQHQHQHQHQHQHQHHHQ 453 Query: 203 H 205 H Sbjct: 454 H 454 >gi|110762942|ref|XP_001122760.1| PREDICTED: hypothetical protein [Apis mellifera] Length = 281 Score = 52 bits (124), Expect = 9e-006 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = +2 Query: 38 LNEFEHQSGNNVGLGVQGIGAQQQQQQHQHQHQLQPQHQLQPQSQLQPPQQHQ 196 LNE + Q + G+G+ QQQQQQ QHQHQ Q QHQ Q Q Q QQ Q Sbjct: 207 LNEQQQQQQGSSGIGLHHHHQQQQQQQQQHQHQHQHQHQQQQHHQQQQQQQQQ 259 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 397,919,240,014 Number of Sequences: 7387702 Number of Extensions: 397919240014 Number of Successful Extensions: 209897449 Number of sequences better than 0.0: 0 |