BLASTX 7.6.2 Query= RU20317 /QuerySize=500 (499 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|187940305|gb|ACD39383.1| NAC domain protein [Glycine max] 122 1e-026 gi|15240252|ref|NP_200951.1| ANAC100/ATNAC5 (Arabidopsis NAC dom... 120 5e-026 gi|62546191|gb|AAX85982.1| NAC5 protein [Glycine max] 120 5e-026 gi|22597158|gb|AAN03466.1| no apical meristem-like protein [Glyc... 120 5e-026 gi|30682048|ref|NP_568182.2| ANAC079/ANAC080/ATNAC4 (Arabidopsis... 119 8e-026 >gi|187940305|gb|ACD39383.1| NAC domain protein [Glycine max] Length = 296 Score = 122 bits (305), Expect = 1e-026 Identities = 53/64 (82%), Positives = 60/64 (93%) Frame = -1 Query: 193 REDDQIDLPPGFRFHPTDEELISHYLHKKVIDSNFGCKAIGDVDLNKSEPWDLPYKAKMG 14 +EDDQ+D PPGFRFHPTDEELISHYL+KKVID+ F +AIG+VDLNKSEPWDLP+KAKMG Sbjct: 9 KEDDQMDFPPGFRFHPTDEELISHYLYKKVIDTKFCARAIGEVDLNKSEPWDLPWKAKMG 68 Query: 13 EKEW 2 EKEW Sbjct: 69 EKEW 72 >gi|15240252|ref|NP_200951.1| ANAC100/ATNAC5 (Arabidopsis NAC domain containing protein 100); transcription factor [Arabidopsis thaliana] Length = 336 Score = 120 bits (300), Expect = 5e-026 Identities = 51/67 (76%), Positives = 62/67 (92%) Frame = -1 Query: 202 GTFREDDQIDLPPGFRFHPTDEELISHYLHKKVIDSNFGCKAIGDVDLNKSEPWDLPYKA 23 G +E++Q+DLPPGFRFHPTDEELI+HYLHKKV+D++F KAIG+VDLNKSEPW+LP+ A Sbjct: 6 GFQKEEEQMDLPPGFRFHPTDEELITHYLHKKVLDTSFSAKAIGEVDLNKSEPWELPWMA 65 Query: 22 KMGEKEW 2 KMGEKEW Sbjct: 66 KMGEKEW 72 >gi|62546191|gb|AAX85982.1| NAC5 protein [Glycine max] Length = 357 Score = 120 bits (300), Expect = 5e-026 Identities = 51/64 (79%), Positives = 60/64 (93%) Frame = -1 Query: 193 REDDQIDLPPGFRFHPTDEELISHYLHKKVIDSNFGCKAIGDVDLNKSEPWDLPYKAKMG 14 +E DQ+DLPPGFRFHPTDEELISHYL++KV D+NF +AIG+VDLN+SEPWDLP+KAKMG Sbjct: 11 KEKDQMDLPPGFRFHPTDEELISHYLYRKVTDTNFSARAIGEVDLNRSEPWDLPWKAKMG 70 Query: 13 EKEW 2 EKEW Sbjct: 71 EKEW 74 >gi|22597158|gb|AAN03466.1| no apical meristem-like protein [Glycine max] Length = 357 Score = 120 bits (300), Expect = 5e-026 Identities = 51/64 (79%), Positives = 60/64 (93%) Frame = -1 Query: 193 REDDQIDLPPGFRFHPTDEELISHYLHKKVIDSNFGCKAIGDVDLNKSEPWDLPYKAKMG 14 +E DQ+DLPPGFRFHPTDEELISHYL++KV D+NF +AIG+VDLN+SEPWDLP+KAKMG Sbjct: 11 KEKDQMDLPPGFRFHPTDEELISHYLYRKVTDTNFSARAIGEVDLNRSEPWDLPWKAKMG 70 Query: 13 EKEW 2 EKEW Sbjct: 71 EKEW 74 >gi|30682048|ref|NP_568182.2| ANAC079/ANAC080/ATNAC4 (Arabidopsis NAC domain containing protein 79, Arabidopsis NAC domain containing protein 80); transcription factor [Arabidopsis thaliana] Length = 329 Score = 119 bits (298), Expect = 8e-026 Identities = 50/63 (79%), Positives = 59/63 (93%) Frame = -1 Query: 190 EDDQIDLPPGFRFHPTDEELISHYLHKKVIDSNFGCKAIGDVDLNKSEPWDLPYKAKMGE 11 +D+Q+DLPPGFRFHPTDEELI+HYLHKKV+D F KAIG+VDLNK+EPW+LPYKAK+GE Sbjct: 11 DDEQMDLPPGFRFHPTDEELITHYLHKKVLDLGFSAKAIGEVDLNKAEPWELPYKAKIGE 70 Query: 10 KEW 2 KEW Sbjct: 71 KEW 73 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 437,497,710,580 Number of Sequences: 7387702 Number of Extensions: 437497710580 Number of Successful Extensions: 219863961 Number of sequences better than 0.0: 0 |