BLASTX 7.6.2 Query= RU22395 /QuerySize=369 (368 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|162458854|ref|NP_001105441.1| ypt homolog2 [Zea mays] 74 2e-012 gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ... 74 2e-012 gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C... 74 2e-012 gi|15236555|ref|NP_193486.1| RAB1C; GTP binding [Arabidopsis tha... 74 2e-012 gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] 74 2e-012 >gi|162458854|ref|NP_001105441.1| ypt homolog2 [Zea mays] Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza sativa] Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [Cicer arietinum] Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >gi|15236555|ref|NP_193486.1| RAB1C; GTP binding [Arabidopsis thaliana] Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 463,804,259,611 Number of Sequences: 7387702 Number of Extensions: 463804259611 Number of Successful Extensions: 251317205 Number of sequences better than 0.0: 0 |