BLASTX 7.6.2 Query= RU22752 /QuerySize=750 (749 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|109487257|ref|XP_001072353.1| PREDICTED: hypothetical protein... 62 5e-008 gi|114800514|ref|YP_760698.1| OmpA family protein [Hyphomonas ne... 59 3e-007 gi|141279|sp|P21260.1|YPRO_OWEFU RecName: Full=Uncharacterized p... 59 3e-007 gi|66823785|ref|XP_645247.1| hypothetical protein [Dictyostelium... 58 6e-007 gi|42761512|gb|AAS45330.1| similar to Volvox carteri f. nagarien... 58 6e-007 >gi|109487257|ref|XP_001072353.1| PREDICTED: hypothetical protein [Rattus norvegicus] Length = 86 Score = 62 bits (148), Expect = 5e-008 Identities = 27/48 (56%), Positives = 29/48 (60%) Frame = -3 Query: 390 WQWRKILMPS*RFRGNSSSNGGGGAGGGGASGGGYGGGGSGEGGGHGG 247 W W L+P+ R G GGGG GGGG GGG GGGG G GGG GG Sbjct: 15 WWWLTPLIPALRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 >gi|114800514|ref|YP_760698.1| OmpA family protein [Hyphomonas neptunium ATCC 15444] Length = 387 Score = 59 bits (142), Expect = 3e-007 Identities = 24/34 (70%) Frame = +2 Query: 248 PP*PPPSPLPPPPYPPPLAPPPPAPPPPLEEEFP 349 PP PPP P PPPP PPP PPPP PPPP EE P Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETTP 264 >gi|141279|sp|P21260.1|YPRO_OWEFU RecName: Full=Uncharacterized proline-rich protein Length = 141 Score = 59 bits (141), Expect = 3e-007 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +2 Query: 248 PP*PPPSPLPPPPYPPPLAPPPPAPPPPLEEEFPLNLQLGIKIF 379 PP PPP P PPPP PPP PPPP PPPP N+ L ++ F Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIPLFLRFF 74 >gi|66823785|ref|XP_645247.1| hypothetical protein [Dictyostelium discoideum AX4] Length = 242 Score = 58 bits (139), Expect = 6e-007 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +2 Query: 248 PP*PPPSPLPPPPYPPPLAPPPPAPPPPLEEEFPLNLQL 364 PP PPP P PPPP PPP PPPP PPPP + L+L+L Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLEL 117 >gi|42761512|gb|AAS45330.1| similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein precursor [Dictyostelium discoideum] Length = 243 Score = 58 bits (139), Expect = 6e-007 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +2 Query: 248 PP*PPPSPLPPPPYPPPLAPPPPAPPPPLEEEFPLNLQL 364 PP PPP P PPPP PPP PPPP PPPP + L+L+L Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLEL 117 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 470,955,923,008 Number of Sequences: 7387702 Number of Extensions: 470955923008 Number of Successful Extensions: 259291540 Number of sequences better than 0.0: 0 |