BLASTX 7.6.2 Query= RU24246 /QuerySize=275 (274 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157337770|emb|CAO22116.1| unnamed protein product [Vitis vini... 70 4e-011 gi|4204265|gb|AAD10646.1| Hypothetical protein [Arabidopsis thal... 63 6e-009 gi|30682679|ref|NP_187955.2| ECT2; protein binding [Arabidopsis ... 59 9e-008 gi|66351942|gb|AAY44715.1| unknown [Arabidopsis thaliana] 59 9e-008 gi|79313219|ref|NP_001030689.1| ECT2 [Arabidopsis thaliana] 59 9e-008 >gi|157337770|emb|CAO22116.1| unnamed protein product [Vitis vinifera] Length = 296 Score = 70 bits (170), Expect = 4e-011 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 124 MATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKKP 231 MA VAPPADQAA+LLQKLSLDSQTKTLEIPEPTKKP Sbjct: 1 MAAVAPPADQAAELLQKLSLDSQTKTLEIPEPTKKP 36 >gi|4204265|gb|AAD10646.1| Hypothetical protein [Arabidopsis thaliana] Length = 580 Score = 63 bits (151), Expect = 6e-009 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = +1 Query: 124 MATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKK 228 M+TVAPPADQAAD+L+KLSLDS+++TLEIPEPTKK Sbjct: 1 MSTVAPPADQAADVLKKLSLDSKSRTLEIPEPTKK 35 >gi|30682679|ref|NP_187955.2| ECT2; protein binding [Arabidopsis thaliana] Length = 667 Score = 59 bits (141), Expect = 9e-008 Identities = 29/35 (82%) Frame = +1 Query: 124 MATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKK 228 MATVAPPADQA DLLQKLSLDS K EIPEP KK Sbjct: 1 MATVAPPADQATDLLQKLSLDSPAKASEIPEPNKK 35 >gi|66351942|gb|AAY44715.1| unknown [Arabidopsis thaliana] Length = 652 Score = 59 bits (141), Expect = 9e-008 Identities = 29/35 (82%) Frame = +1 Query: 124 MATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKK 228 MATVAPPADQA DLLQKLSLDS K EIPEP KK Sbjct: 1 MATVAPPADQATDLLQKLSLDSPAKASEIPEPNKK 35 >gi|79313219|ref|NP_001030689.1| ECT2 [Arabidopsis thaliana] Length = 508 Score = 59 bits (141), Expect = 9e-008 Identities = 29/35 (82%) Frame = +1 Query: 124 MATVAPPADQAADLLQKLSLDSQTKTLEIPEPTKK 228 MATVAPPADQA DLLQKLSLDS K EIPEP KK Sbjct: 1 MATVAPPADQATDLLQKLSLDSPAKASEIPEPNKK 35 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 544,304,915,632 Number of Sequences: 7387702 Number of Extensions: 544304915632 Number of Successful Extensions: 309755150 Number of sequences better than 0.0: 0 |