BLASTX 7.6.2 Query= RU24845 /QuerySize=349 (348 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|186529597|ref|NP_001119378.1| CPuORF24 (Conserved peptide ups... 64 3e-009 gi|186512037|ref|NP_001119011.1| CPuORF25 (Conserved peptide ups... 63 6e-009 >gi|186529597|ref|NP_001119378.1| CPuORF24 (Conserved peptide upstream open reading frame 24) [Arabidopsis thaliana] Length = 41 Score = 64 bits (153), Expect = 3e-009 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 140 MEQVRLLSNCHQYRVFSFQEVLDWRFLVLGDFLLVSFVNCT 18 MEQ + S C+QYRVFS QE LDWRFLV DFL+ SFVNCT Sbjct: 1 MEQDYICSGCYQYRVFSLQEALDWRFLVHSDFLIGSFVNCT 41 >gi|186512037|ref|NP_001119011.1| CPuORF25 (Conserved peptide upstream open reading frame 25) [Arabidopsis thaliana] Length = 41 Score = 63 bits (151), Expect = 6e-009 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 140 MEQVRLLSNCHQYRVFSFQEVLDWRFLVLGDFLLVSFVNCT 18 MEQV + +C+ YR+FSFQE LDWRFLV DFL+ SFVNCT Sbjct: 1 MEQVFVWPSCYHYRLFSFQEALDWRFLVRSDFLVGSFVNCT 41 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 544,304,915,632 Number of Sequences: 7387702 Number of Extensions: 544304915632 Number of Successful Extensions: 309755150 Number of sequences better than 0.0: 0 |