BLASTX 7.6.2 Query= RU25412 /QuerySize=483 (482 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|8698895|gb|AAF78513.1|AF195212_1 putative transciption factor... 69 9e-011 gi|157342668|emb|CAO65380.1| unnamed protein product [Vitis vini... 64 2e-009 gi|2104685|emb|CAA66483.1| transcripteion factor [Vicia faba var... 64 3e-009 gi|134054013|gb|ABD28323.2| Excinuclease ABC, C subunit, N-termi... 63 4e-009 >gi|8698895|gb|AAF78513.1|AF195212_1 putative transciption factor [Pyrus pyrifolia] Length = 104 Score = 69 bits (166), Expect = 9e-011 Identities = 33/51 (64%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = +2 Query: 26 KSEALRTERQQLDKYDYAWNKSFNGARRPDDVLQKPKKISSKPT-FSDYAD 175 KS+AL+TE Q LD +DYAWN + NGARRPDDVL+K KKISS T F+++A+ Sbjct: 4 KSDALKTETQLLDTFDYAWNTTINGARRPDDVLRKLKKISSSTTRFANFAE 54 >gi|157342668|emb|CAO65380.1| unnamed protein product [Vitis vinifera] Length = 547 Score = 64 bits (154), Expect = 2e-009 Identities = 33/77 (42%), Positives = 43/77 (55%), Gaps = 3/77 (3%) Frame = +2 Query: 143 SSKPTFSD---YADWDGRNLIPQVIKFGRSQPRSVLDGNGITWENTGIWGARTNTGSACR 313 +SKP + D D +L+ +V KFGRSQPR V D G+T G G+ C Sbjct: 211 ASKPFLQENGLSTDQDINSLLARVFKFGRSQPRLVSDRVGVTGNYNSTCGVALGDGTICE 270 Query: 314 RPPVQGSQRCAVHKGRR 364 RPPV+G +RCA HKG + Sbjct: 271 RPPVEGRKRCAEHKGMK 287 Score = 62 bits (150), Expect = 6e-009 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = +2 Query: 5 RWAPTGTKSEALRTERQQLDKYDYAWNKSFNGARRPDDVLQKPKKISS 148 RWAP +K +A RTE + L +DYAWNK NGARRP DVL+K +K SS Sbjct: 138 RWAPIESKRDAERTESRLLKTFDYAWNKGSNGARRPSDVLRKLEKTSS 185 >gi|2104685|emb|CAA66483.1| transcripteion factor [Vicia faba var. minor] Length = 377 Score = 64 bits (153), Expect = 3e-009 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 5/67 (7%) Frame = +2 Query: 2 HRWAPTGTKSEALRTERQQLDKYDYAWNKSFNGARRPDDVLQKPKKISS-KPTFSDYADW 178 +RWAP K +AL+TE Q L +DYAWN NG RRP D+LQ KISS TFS+ A Sbjct: 140 YRWAPMQNKGDALQTESQLLSTFDYAWNTINNGTRRPADILQMLNKISSGTRTFSEVA-- 197 Query: 179 DGRNLIP 199 ++L+P Sbjct: 198 --KSLVP 202 >gi|134054013|gb|ABD28323.2| Excinuclease ABC, C subunit, N-terminal, putative [Medicago truncatula] Length = 441 Score = 63 bits (152), Expect = 4e-009 Identities = 31/58 (53%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +2 Query: 2 HRWAPTGTKSEALRTERQQLDKYDYAWNKSFNGARRPDDVLQKPKKISS-KPTFSDYA 172 +RWAP + +ALRTE Q L +DYAWN NG RRPDD+ Q K++S TFSD A Sbjct: 201 YRWAPMQNEGDALRTESQLLSTFDYAWNTISNGTRRPDDIHQMLNKLASGTRTFSDVA 258 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 544,304,915,632 Number of Sequences: 7387702 Number of Extensions: 544304915632 Number of Successful Extensions: 309755150 Number of sequences better than 0.0: 0 |