BLASTX 7.6.2 Query= RU26027 /QuerySize=404 (403 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147811360|emb|CAN61228.1| hypothetical protein [Vitis vinifera] 60 3e-008 gi|157340163|emb|CAO45840.1| unnamed protein product [Vitis vini... 57 4e-007 >gi|147811360|emb|CAN61228.1| hypothetical protein [Vitis vinifera] Length = 342 Score = 60 bits (145), Expect = 3e-008 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -2 Query: 258 PIFPADFGSRNFNEVPFSSDLCVPYDDLAELEWQLSSFSEERF 130 P F D GSRN+ + FSSDLCVPYDDLAELEW LS+ EE F Sbjct: 83 PQFAGDIGSRNYTDAHFSSDLCVPYDDLAELEW-LSNIVEESF 124 Score = 52 bits (123), Expect = 9e-006 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 5/50 (10%) Frame = -1 Query: 163 MAALEFLGG----AFSSEDLQKLQLISGMKARPDEAASETRHFQPDPNNH 26 +A LE+L +FSSEDL+KLQLISGMKA +E ASETR FQP+ N + Sbjct: 110 LAELEWLSNIVEESFSSEDLEKLQLISGMKANTEE-ASETRDFQPENNQN 158 >gi|157340163|emb|CAO45840.1| unnamed protein product [Vitis vinifera] Length = 329 Score = 57 bits (135), Expect = 4e-007 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -2 Query: 270 AANRPIFPADFGSRNFNEVPFSSDLCVPYDDLAELEWQLSSFSEERF 130 + N P F D G RNF + FS +LCVP D+LAELEW LS+F EE F Sbjct: 76 SGNEPHFSGDVGCRNFTDAQFSGELCVPCDELAELEW-LSNFVEESF 121 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 550,909,531,809 Number of Sequences: 7387702 Number of Extensions: 550909531809 Number of Successful Extensions: 317285675 Number of sequences better than 0.0: 0 |