BLASTX 7.6.2 Query= RU26413 /QuerySize=295 (294 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157343857|emb|CAO68363.1| unnamed protein product [Vitis vini... 65 9e-010 gi|117927823|ref|YP_872374.1| glycoside hydrolase family protein... 57 3e-007 gi|116059946|emb|CAL56005.1| Predicted membrane protein (patched... 57 3e-007 gi|55740439|gb|AAV63985.1| hydroxyproline-rich glycoprotein VSP-... 55 2e-006 gi|73852606|ref|YP_293890.1| hypothetical protein EhV137 [Emilia... 53 5e-006 >gi|157343857|emb|CAO68363.1| unnamed protein product [Vitis vinifera] Length = 546 Score = 65 bits (158), Expect = 9e-010 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +2 Query: 125 LLTCLSSEIPLVQTFKGKWALIQAKLPVLQAQLTDFAGFPTSTSNPLALDLLLSVS 292 L++ LS EIP +QTFKGKWA+I+ KL L+ Q+ DF FP SNPL+++L+ S+S Sbjct: 12 LISSLSDEIPHIQTFKGKWAVIRGKLGDLRTQVADFGDFPGFKSNPLSMELMQSIS 67 >gi|117927823|ref|YP_872374.1| glycoside hydrolase family protein [Acidothermus cellulolyticus 11B] Length = 1209 Score = 57 bits (137), Expect = 3e-007 Identities = 36/75 (48%), Positives = 41/75 (54%), Gaps = 4/75 (5%) Frame = +3 Query: 72 VPP*KTQKPTTP*PSPPTSSLVSPRKSRSSKPSRANGP*SRRSSPSSRPS-SPTSPASPP 248 VP + P P PSP S SP S SS PS + P SSPS PS SP+ +SP Sbjct: 457 VPTSTSSSPPPPPPSPSASPSPSPSPSPSSSPSPSPSP---SSSPSPSPSPSPSPSSSPS 513 Query: 249 PPPTLSPSTSSSPSP 293 P P+ SPS S SPSP Sbjct: 514 PSPSSSPSPSPSPSP 528 >gi|116059946|emb|CAL56005.1| Predicted membrane protein (patched superfamily) (ISS) [Ostreococcus tauri] Length = 1449 Score = 57 bits (137), Expect = 3e-007 Identities = 32/74 (43%), Positives = 34/74 (45%) Frame = +3 Query: 69 PVPP*KTQKPTTP*PSPPTSSLVSPRKSRSSKPSRANGP*SRRSSPSSRPSSPTSPASPP 248 P PP P P PSPP S +P P A P S P S P SP P SPP Sbjct: 830 PSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPP 889 Query: 249 PPPTLSPSTSSSPS 290 PPP+ PS S PS Sbjct: 890 PPPSPPPSPSPPPS 903 >gi|55740439|gb|AAV63985.1| hydroxyproline-rich glycoprotein VSP-3 [Chlamydomonas incerta] Length = 465 Score = 55 bits (130), Expect = 2e-006 Identities = 35/76 (46%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 69 PVPP*KTQKPTTP*PSPPTSSLVSPRKSRSSKPSRANGP*SRRSSPSSRPS-SPTSPASP 245 P P K +P PSP S SP+ S S PS + P S + SPS PS SP+ SP Sbjct: 325 PSPSPKASPSPSPSPSPSPSPSPSPKASPSPSPSPSVQP-SSKPSPSPSPSPSPSPSPSP 383 Query: 246 PPPPTLSPSTSSSPSP 293 P P SPS S SPSP Sbjct: 384 SPSPKASPSPSPSPSP 399 >gi|73852606|ref|YP_293890.1| hypothetical protein EhV137 [Emiliania huxleyi virus 86] Length = 516 Score = 53 bits (126), Expect = 5e-006 Identities = 29/75 (38%), Positives = 34/75 (45%) Frame = +3 Query: 69 PVPP*KTQKPTTP*PSPPTSSLVSPRKSRSSKPSRANGP*SRRSSPSSRPSSPTSPASPP 248 P P P +P PSPP S P S P + P S SP PS P+ P P Sbjct: 78 PPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSP 137 Query: 249 PPPTLSPSTSSSPSP 293 PPP++SPS P P Sbjct: 138 PPPSISPSPPPPPPP 152 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 557,520,039,616 Number of Sequences: 7387702 Number of Extensions: 557520039616 Number of Successful Extensions: 325166908 Number of sequences better than 0.0: 0 |