BLASTX 7.6.2 Query= RU26859 /QuerySize=586 (585 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147799039|emb|CAN65872.1| hypothetical protein [Vitis vinifera] 60 1e-007 gi|21314549|gb|AAM47000.1|AF512542_1 alpha-expansin precursor [G... 59 2e-007 gi|115334948|gb|ABI94060.1| ripening-related expansin [Cucumis m... 59 2e-007 gi|150022231|gb|ABR57443.1| alpha-expansin 4 [Gossypium arboreum] 59 2e-007 gi|150022237|gb|ABR57446.1| alpha-expansin 4 [Gossypium raimondii] 59 2e-007 >gi|147799039|emb|CAN65872.1| hypothetical protein [Vitis vinifera] Length = 258 Score = 60 bits (143), Expect = 1e-007 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 481 GSDRRSSTTYNVAPANWQFGQTYSGKNFRV 392 GSDRR+ST++NVAPANWQFGQT+SG+NFR+ Sbjct: 229 GSDRRTSTSWNVAPANWQFGQTFSGRNFRI 258 >gi|21314549|gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum] Length = 264 Score = 59 bits (141), Expect = 2e-007 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 481 GSDRRSSTTYNVAPANWQFGQTYSGKNFRV 392 GSDRR+ST+ NVAPANWQFGQT++GKNFRV Sbjct: 235 GSDRRTSTSLNVAPANWQFGQTFTGKNFRV 264 >gi|115334948|gb|ABI94060.1| ripening-related expansin [Cucumis melo] Length = 259 Score = 59 bits (141), Expect = 2e-007 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -3 Query: 481 GSDRRSSTTYNVAPANWQFGQTYSGKNFRV 392 GSDRR+ST++NVAP+NWQFGQT++GKNFRV Sbjct: 230 GSDRRTSTSWNVAPSNWQFGQTFTGKNFRV 259 >gi|150022231|gb|ABR57443.1| alpha-expansin 4 [Gossypium arboreum] Length = 66 Score = 59 bits (141), Expect = 2e-007 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 481 GSDRRSSTTYNVAPANWQFGQTYSGKNFRV 392 GSDRR+ST+ NVAPANWQFGQT++GKNFRV Sbjct: 37 GSDRRTSTSLNVAPANWQFGQTFTGKNFRV 66 >gi|150022237|gb|ABR57446.1| alpha-expansin 4 [Gossypium raimondii] Length = 66 Score = 59 bits (141), Expect = 2e-007 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 481 GSDRRSSTTYNVAPANWQFGQTYSGKNFRV 392 GSDRR+ST+ NVAPANWQFGQT++GKNFRV Sbjct: 37 GSDRRTSTSLNVAPANWQFGQTFTGKNFRV 66 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 571,315,562,616 Number of Sequences: 7387702 Number of Extensions: 571315562616 Number of Successful Extensions: 339919939 Number of sequences better than 0.0: 0 |