BLASTX 7.6.2 Query= RU26877 /QuerySize=450 (449 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|15234839|ref|NP_194229.1| ATGP4 (Arabidopsis thaliana geranyl... 61 1e-008 gi|4097567|gb|AAD00115.1| ATGP4 [Arabidopsis thaliana] 61 1e-008 gi|147861753|emb|CAN83168.1| hypothetical protein [Vitis vinifera] 60 4e-008 gi|157343832|emb|CAO68338.1| unnamed protein product [Vitis vini... 60 4e-008 gi|121628|sp|P10495.1|GRP1_PHAVU RecName: Full=Glycine-rich cell... 54 2e-006 >gi|15234839|ref|NP_194229.1| ATGP4 (Arabidopsis thaliana geranylgeranylated protein) Length = 118 Score = 61 bits (147), Expect = 1e-008 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 449 TMIPKTWNEVKLMCFGKILENSKTVGQCKLPFGDVGGG 336 T++PK NEVKL+ GKILEN+KTVGQCK PFGD+ GG Sbjct: 46 TVVPKGINEVKLISSGKILENNKTVGQCKTPFGDIAGG 83 >gi|4097567|gb|AAD00115.1| ATGP4 [Arabidopsis thaliana] Length = 118 Score = 61 bits (147), Expect = 1e-008 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 449 TMIPKTWNEVKLMCFGKILENSKTVGQCKLPFGDVGGG 336 T++PK NEVKL+ GKILEN+KTVGQCK PFGD+ GG Sbjct: 46 TVVPKGINEVKLITSGKILENNKTVGQCKTPFGDIAGG 83 >gi|147861753|emb|CAN83168.1| hypothetical protein [Vitis vinifera] Length = 111 Score = 60 bits (143), Expect = 4e-008 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 449 TMIPKTWNEVKLMCFGKILENSKTVGQCKLPFGDVGGG 336 T+IPK NEVKL+ GKILEN KTVGQC++PFG++ GG Sbjct: 39 TIIPKAANEVKLISSGKILENDKTVGQCRIPFGELAGG 76 >gi|157343832|emb|CAO68338.1| unnamed protein product [Vitis vinifera] Length = 117 Score = 60 bits (143), Expect = 4e-008 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 449 TMIPKTWNEVKLMCFGKILENSKTVGQCKLPFGDVGGG 336 T+IPK NEVKL+ GKILEN KTVGQC++PFG++ GG Sbjct: 45 TIIPKAANEVKLISSGKILENDKTVGQCRIPFGELAGG 82 >gi|121628|sp|P10495.1|GRP1_PHAVU RecName: Full=Glycine-rich cell wall structural protein 1.0; Short=GRP 1.0; Flags: Precursor Length = 252 Score = 54 bits (129), Expect = 2e-006 Identities = 24/31 (77%), Gaps = 1/31 (3%) Frame = -1 Query: 353 GDVGGGGAHGGAYGGGGGSGEGGGH-GGYIP 264 G GGGGA G YGGGGGSGEGGGH GGY P Sbjct: 222 GGYGGGGARGSGYGGGGGSGEGGGHGGGYYP 252 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 610,480,162,245 Number of Sequences: 7387702 Number of Extensions: 610480162245 Number of Successful Extensions: 349624587 Number of sequences better than 0.0: 0 |