BLASTX 7.6.2 Query= RU27749 /QuerySize=496 (495 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|7239508|gb|AAF43234.1|AC012654_18 EST gb|AI998820 comes from ... 56 8e-007 gi|18409920|ref|NP_565025.1| ABC1 family protein [Arabidopsis th... 56 8e-007 gi|157359396|emb|CAO67557.1| unnamed protein product [Vitis vini... 56 8e-007 >gi|7239508|gb|AAF43234.1|AC012654_18 EST gb|AI998820 comes from this gene. [Arabidopsis thaliana] Length = 649 Score = 56 bits (134), Expect = 8e-007 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 397 FKVRAAELRQILVELGPAYIKIAQAISSRP 486 FKVRAAELR++LVELGPAY+KIAQA+SSRP Sbjct: 116 FKVRAAELRKLLVELGPAYVKIAQAVSSRP 145 >gi|18409920|ref|NP_565025.1| ABC1 family protein [Arabidopsis thaliana] Length = 692 Score = 56 bits (134), Expect = 8e-007 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 397 FKVRAAELRQILVELGPAYIKIAQAISSRP 486 FKVRAAELR++LVELGPAY+KIAQA+SSRP Sbjct: 116 FKVRAAELRKLLVELGPAYVKIAQAVSSRP 145 >gi|157359396|emb|CAO67557.1| unnamed protein product [Vitis vinifera] Length = 712 Score = 56 bits (134), Expect = 8e-007 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 397 FKVRAAELRQILVELGPAYIKIAQAISSRP 486 F+VRAAELR+ILVELGPAYIKIAQAISSRP Sbjct: 124 FEVRAAELRKILVELGPAYIKIAQAISSRP 153 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 610,480,162,245 Number of Sequences: 7387702 Number of Extensions: 610480162245 Number of Successful Extensions: 349624587 Number of sequences better than 0.0: 0 |