BLASTX 7.6.2 Query= RU27788 /QuerySize=504 (503 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157352203|emb|CAO43231.1| unnamed protein product [Vitis vini... 77 4e-013 gi|15242127|ref|NP_200552.1| IAA33 (indoleacetic acid-induced pr... 64 4e-009 >gi|157352203|emb|CAO43231.1| unnamed protein product [Vitis vinifera] Length = 168 Score = 77 bits (189), Expect = 4e-013 Identities = 48/90 (53%), Positives = 54/90 (60%), Gaps = 19/90 (21%) Frame = +1 Query: 265 FQSQRQDSL-KRRWQE----------IRRSSATTQPSSDMIRKPNGALNGFPGLLGDDDL 411 FQ Q QDS RRW + RR++A QPSS I+ FPG L DDDL Sbjct: 6 FQHQTQDSFDSRRWSQNHRPSSAGFYARRAAAPPQPSSSSIQT-------FPG-LADDDL 57 Query: 412 VSTLVPPVTVVLEGRSICQRISLQKHTSYQ 501 V+ +VPPVTVVLEGRSIC RISL H SYQ Sbjct: 58 VAAVVPPVTVVLEGRSICHRISLHSHASYQ 87 >gi|15242127|ref|NP_200552.1| IAA33 (indoleacetic acid-induced protein 33); transcription factor [Arabidopsis thaliana] Length = 171 Score = 64 bits (154), Expect = 4e-009 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +1 Query: 370 ALNGFPGLLGDDDLVSTLVPPVTVVLEGRSICQRISLQKHTSYQ 501 + GF GL +DDLVS++VPPVTVVLEGRSICQRISL KH SYQ Sbjct: 55 SFQGF-GLNVEDDLVSSVVPPVTVVLEGRSICQRISLDKHGSYQ 97 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 610,480,162,245 Number of Sequences: 7387702 Number of Extensions: 610480162245 Number of Successful Extensions: 349624587 Number of sequences better than 0.0: 0 |