BLASTX 7.6.2 Query= RU28398 /QuerySize=167 (166 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147788706|emb|CAN65294.1| hypothetical protein [Vitis vinifera] 57 3e-007 >gi|147788706|emb|CAN65294.1| hypothetical protein [Vitis vinifera] Length = 167 Score = 57 bits (137), Expect = 3e-007 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = -3 Query: 164 ILRWVPSPPTRSQVDSALRAVPRESKTTTTTTLCPAQFKQWAVELFAGAVVGNA 3 I RWVPSPPT+ QVD ALR V R + TL +FK + VELFA AVV A Sbjct: 64 IKRWVPSPPTQLQVDRALRVVTRSGDSVQDQTLGRVEFKAFEVELFADAVVAGA 117 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 610,480,162,245 Number of Sequences: 7387702 Number of Extensions: 610480162245 Number of Successful Extensions: 349624587 Number of sequences better than 0.0: 0 |