BLASTX 7.6.2 Query= RU33200 /QuerySize=240 (239 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|18401882|ref|NP_566609.1| tetratricopeptide repeat (TPR)-cont... 52 9e-006 >gi|18401882|ref|NP_566609.1| tetratricopeptide repeat (TPR)-containing protein [Arabidopsis thaliana] Length = 316 Score = 52 bits (124), Expect = 9e-006 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 4/79 (5%) Frame = -2 Query: 238 AILIGVTATVFHNSSKLLARADPPPPATLTEEEEEAAPNQGQNETQASPLSDFLGSNSDA 59 AILIG ++ S L +A+ P T+ + EE + + ++ +PLS+ L S +A Sbjct: 62 AILIGAAVSMTGKFSTLPVKAE-SPVTTIEKTYEEV---KEEKLSEITPLSELLDSTPEA 117 Query: 58 VDALKSLLQQKLENGEDDE 2 V+ L+SLLQQKLE GED+E Sbjct: 118 VETLRSLLQQKLEKGEDEE 136 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 652,910,913,070 Number of Sequences: 7387702 Number of Extensions: 652910913070 Number of Successful Extensions: 368049500 Number of sequences better than 0.0: 0 |