BLASTX 7.6.2 Query= RU33428 /QuerySize=160 (159 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|73658532|emb|CAJ27130.1| putative TIR-NBS-LRR resistance prot... 71 3e-011 gi|157346436|emb|CAO16319.1| unnamed protein product [Vitis vini... 53 6e-006 >gi|73658532|emb|CAJ27130.1| putative TIR-NBS-LRR resistance protein [Rosa hybrid cultivar] Length = 213 Score = 71 bits (172), Expect = 3e-011 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -3 Query: 157 ASKLFNLSAFKGSICPDDFTELVTEVRHYAKGIPLVLEVLGSDLCGKDKDE 5 A +LFN +AFKG+I DDF +L T V YAKGIPL LEVLGSDLC K+KDE Sbjct: 128 ALELFNFNAFKGNIHMDDFFDLATGVIRYAKGIPLALEVLGSDLCSKNKDE 178 >gi|157346436|emb|CAO16319.1| unnamed protein product [Vitis vinifera] Length = 557 Score = 53 bits (126), Expect = 6e-006 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 157 ASKLFNLSAFKGSICPDDFTELVTEVRHYAKGIPLVLEVLGSDLCGKDKDE 5 A+KLFN AF+ D EL+ V YA+G+PL L+VLGS LC K KDE Sbjct: 355 ATKLFNHYAFRNDTPSRDVIELIDHVIAYAQGLPLALKVLGSSLCKKSKDE 405 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 652,910,913,070 Number of Sequences: 7387702 Number of Extensions: 652910913070 Number of Successful Extensions: 368049500 Number of sequences better than 0.0: 0 |