BLASTX 7.6.2 Query= RU33526 /QuerySize=186 (185 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147804884|emb|CAN60381.1| hypothetical protein [Vitis vinifera] 57 5e-007 gi|157343784|emb|CAO68290.1| unnamed protein product [Vitis vini... 57 5e-007 >gi|147804884|emb|CAN60381.1| hypothetical protein [Vitis vinifera] Length = 217 Score = 57 bits (135), Expect = 5e-007 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 132 MEGFSSQPSDSNQAASGASISLQNLPSRGLFSAPVLSLNPGRMR 1 M+ SSQPS+SNQ AS AS L NLPSRGLFS+ V+S NPG MR Sbjct: 1 MDTTSSQPSNSNQTASEASKYLVNLPSRGLFSSTVISSNPGGMR 44 >gi|157343784|emb|CAO68290.1| unnamed protein product [Vitis vinifera] Length = 172 Score = 57 bits (135), Expect = 5e-007 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 132 MEGFSSQPSDSNQAASGASISLQNLPSRGLFSAPVLSLNPGRMR 1 M+ SSQPS+SNQ AS AS L NLPSRGLFS+ V+S NPG MR Sbjct: 1 MDTTSSQPSNSNQTASEASKYLVNLPSRGLFSSTVISSNPGGMR 44 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 652,910,913,070 Number of Sequences: 7387702 Number of Extensions: 652910913070 Number of Successful Extensions: 368049500 Number of sequences better than 0.0: 0 |