BLASTX 7.6.2 Query= RU35634 /QuerySize=230 (229 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147785392|emb|CAN68680.1| hypothetical protein [Vitis vinifera] 63 5e-009 >gi|147785392|emb|CAN68680.1| hypothetical protein [Vitis vinifera] Length = 124 Score = 63 bits (152), Expect = 5e-009 Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -1 Query: 148 MNRRARTTHRSSPNRSEPFLKYLKPGALAQIRDSRISSSRSHRINWISQ 2 MNRR R HRSS R E F +YLKPGALAQ+RDSRI S+RSHR++ SQ Sbjct: 1 MNRRIRXLHRSSSKRDEAFHRYLKPGALAQLRDSRI-SARSHRVDSHSQ 48 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,104,830,980 Number of Sequences: 7387702 Number of Extensions: 43104830980 Number of Successful Extensions: 18401489 Number of sequences better than 0.0: 0 |