BLASTX 7.6.2 Query= RU36073 /QuerySize=265 (264 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|4588012|gb|AAD25952.1|AF085717_1 putative callose synthase ca... 58 2e-007 gi|157337664|emb|CAO22010.1| unnamed protein product [Vitis vini... 58 2e-007 gi|168005880|ref|XP_001755638.1| predicted protein [Physcomitrel... 57 3e-007 gi|15231404|ref|NP_187372.1| ATGSL10 (GLUCAN SYNTHASE-LIKE 10); ... 57 5e-007 gi|20466536|gb|AAM20585.1| putative glucan synthase [Arabidopsis... 57 5e-007 >gi|4588012|gb|AAD25952.1|AF085717_1 putative callose synthase catalytic subunit [Gossypium hirsutum] Length = 1899 Score = 58 bits (138), Expect = 2e-007 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHLLETTP 166 WFPFVSTFQTRLMFNQAFSRGLEIS+ L P Sbjct: 1863 WFPFVSTFQTRLMFNQAFSRGLEISLILAGNNP 1895 >gi|157337664|emb|CAO22010.1| unnamed protein product [Vitis vinifera] Length = 1918 Score = 58 bits (138), Expect = 2e-007 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHLLETTP 166 WFPFVSTFQTRLMFNQAFSRGLEIS+ L P Sbjct: 1882 WFPFVSTFQTRLMFNQAFSRGLEISLILAGNNP 1914 >gi|168005880|ref|XP_001755638.1| predicted protein [Physcomitrella patens subsp. patens] Length = 1928 Score = 57 bits (136), Expect = 3e-007 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHLLETTP 166 WFPFVSTFQTRL+FNQAFSRGLEISV L P Sbjct: 1892 WFPFVSTFQTRLVFNQAFSRGLEISVLLAGDNP 1924 >gi|15231404|ref|NP_187372.1| ATGSL10 (GLUCAN SYNTHASE-LIKE 10); 1,3-beta-glucan synthase [Arabidopsis thaliana] Length = 1931 Score = 57 bits (135), Expect = 5e-007 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHLLETTP 166 WFPFVSTFQTR+MFNQAFSRGLEIS+ L P Sbjct: 1895 WFPFVSTFQTRMMFNQAFSRGLEISLILAGDNP 1927 >gi|20466536|gb|AAM20585.1| putative glucan synthase [Arabidopsis thaliana] Length = 436 Score = 57 bits (135), Expect = 5e-007 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 264 WFPFVSTFQTRLMFNQAFSRGLEISVHLLETTP 166 WFPFVSTFQTR+MFNQAFSRGLEIS+ L P Sbjct: 400 WFPFVSTFQTRMMFNQAFSRGLEISLILAGDNP 432 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,104,830,980 Number of Sequences: 7387702 Number of Extensions: 43104830980 Number of Successful Extensions: 18401489 Number of sequences better than 0.0: 0 |