BLASTX 7.6.2 Query= RU37376 /QuerySize=234 (233 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157356622|emb|CAO62817.1| unnamed protein product [Vitis vini... 67 5e-010 gi|147854130|emb|CAN81318.1| hypothetical protein [Vitis vinifera] 55 1e-006 >gi|157356622|emb|CAO62817.1| unnamed protein product [Vitis vinifera] Length = 540 Score = 67 bits (161), Expect = 5e-010 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 4/51 (7%) Frame = +1 Query: 49 RPRAVEKGVVGPNLSASSSSSSGSSLTIPSAPVYYPSEDEFRDPLEYICKI 201 RPRAVEKGV+G SSS S SL IP PVYYPSEDEF+DPLEYI +I Sbjct: 5 RPRAVEKGVLG----QSSSVSLSGSLGIPPGPVYYPSEDEFKDPLEYIYRI 51 >gi|147854130|emb|CAN81318.1| hypothetical protein [Vitis vinifera] Length = 692 Score = 55 bits (131), Expect = 1e-006 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 4/57 (7%) Frame = +1 Query: 31 VLMGKGRPRAVEKGVVGPNLSASSSSSSGSSLTIPSAPVYYPSEDEFRDPLEYICKI 201 V G+G KG +G + S S S SL+IP PVYYPSEDEF+DPLEYI +I Sbjct: 71 VKWGRGDLGQWRKGCLGQSXSVSLS----GSLSIPPGPVYYPSEDEFKDPLEYIYRI 123 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,104,830,980 Number of Sequences: 7387702 Number of Extensions: 43104830980 Number of Successful Extensions: 18401489 Number of sequences better than 0.0: 0 |