BLASTX 7.6.2 Query= RU37617 /QuerySize=241 (240 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147845457|emb|CAN83346.1| hypothetical protein [Vitis vinifera] 58 2e-007 gi|18419937|ref|NP_568010.1| SPT (SPATULA); DNA binding / transc... 57 3e-007 gi|15240202|ref|NP_201512.1| ALC (ALCATRAZ); DNA binding / trans... 57 3e-007 gi|51970054|dbj|BAD43719.1| putative bHLH transcription factor (... 57 3e-007 gi|55296133|dbj|BAD67851.1| basic helix-loop-helix protein SPATU... 57 3e-007 >gi|147845457|emb|CAN83346.1| hypothetical protein [Vitis vinifera] Length = 489 Score = 58 bits (138), Expect = 2e-007 Identities = 29/31 (93%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQRGE 195 IPNSNKTDKASMLDEAIEYLKQLQLQVQ E Sbjct: 207 IPNSNKTDKASMLDEAIEYLKQLQLQVQNLE 237 >gi|18419937|ref|NP_568010.1| SPT (SPATULA); DNA binding / transcription factor [Arabidopsis thaliana] Length = 373 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 224 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 251 >gi|15240202|ref|NP_201512.1| ALC (ALCATRAZ); DNA binding / transcription factor [Arabidopsis thaliana] Length = 210 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 120 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 147 >gi|51970054|dbj|BAD43719.1| putative bHLH transcription factor (bHLH073/ALCATRAZ) [Arabidopsis thaliana] Length = 210 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 120 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 147 >gi|55296133|dbj|BAD67851.1| basic helix-loop-helix protein SPATULA-like [Oryza sativa Japonica Group] Length = 315 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 130 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 157 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,104,830,980 Number of Sequences: 7387702 Number of Extensions: 43104830980 Number of Successful Extensions: 18401489 Number of sequences better than 0.0: 0 |