BLASTX 7.6.2 Query= RU38712 /QuerySize=117 (116 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|47499339|gb|AAT28427.1| potential resistance protein [Rosa ro... 73 7e-012 gi|47499331|gb|AAT28423.1| potential resistance protein [Rosa ro... 73 7e-012 gi|47499333|gb|AAT28424.1| potential resistance protein [Rosa ro... 73 7e-012 gi|47499329|gb|AAT28422.1| potential resistance protein [Rosa ro... 73 7e-012 gi|47499335|gb|AAT28425.1| potential resistance protein [Rosa ro... 70 6e-011 >gi|47499339|gb|AAT28427.1| potential resistance protein [Rosa roxburghii] Length = 168 Score = 73 bits (177), Expect = 7e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 114 CLQVFEQHVSNDRPPNFELLKEKIVTNCNGLPLA 13 CLQVFEQHVSNDRPPNF+LLK+KIVTNCNGLPLA Sbjct: 134 CLQVFEQHVSNDRPPNFDLLKKKIVTNCNGLPLA 167 >gi|47499331|gb|AAT28423.1| potential resistance protein [Rosa roxburghii] Length = 169 Score = 73 bits (177), Expect = 7e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 114 CLQVFEQHVSNDRPPNFELLKEKIVTNCNGLPLA 13 CLQVFEQHVSNDRPPNF+LLK+KIVTNCNGLPLA Sbjct: 135 CLQVFEQHVSNDRPPNFDLLKKKIVTNCNGLPLA 168 >gi|47499333|gb|AAT28424.1| potential resistance protein [Rosa roxburghii] Length = 169 Score = 73 bits (177), Expect = 7e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 114 CLQVFEQHVSNDRPPNFELLKEKIVTNCNGLPLA 13 CLQVFEQHVSNDRPPNF+LLK+KIVTNCNGLPLA Sbjct: 135 CLQVFEQHVSNDRPPNFDLLKKKIVTNCNGLPLA 168 >gi|47499329|gb|AAT28422.1| potential resistance protein [Rosa roxburghii] Length = 169 Score = 73 bits (177), Expect = 7e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 114 CLQVFEQHVSNDRPPNFELLKEKIVTNCNGLPLA 13 CLQVFEQHVSNDRPPNF+LLK+KIVTNCNGLPLA Sbjct: 135 CLQVFEQHVSNDRPPNFDLLKKKIVTNCNGLPLA 168 >gi|47499335|gb|AAT28425.1| potential resistance protein [Rosa roxburghii] Length = 166 Score = 70 bits (169), Expect = 6e-011 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 114 CLQVFEQHVSNDRPPNFELLKEKIVTNCNGLP 19 CLQVFEQHVSNDRPPNF+LLK+KIVTNCNGLP Sbjct: 135 CLQVFEQHVSNDRPPNFDLLKKKIVTNCNGLP 166 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,104,830,980 Number of Sequences: 7387702 Number of Extensions: 43104830980 Number of Successful Extensions: 18401489 Number of sequences better than 0.0: 0 |