BLASTX 7.6.2 Query= RU40327 /QuerySize=181 (180 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|33340591|gb|AAQ14866.1|AF329450_1 transcription factor BZIP1 ... 105 1e-021 gi|18402186|ref|NP_566629.1| ABF4 (ABRE BINDING FACTOR 4); DNA b... 97 3e-019 gi|94503774|gb|ABF29696.1| abscisic acid responsive element-bind... 91 2e-017 gi|67906424|gb|AAY82589.1| bZIP [Nicotiana tabacum] 90 4e-017 gi|42561991|gb|AAS20434.1| AREB-like protein [Lycopersicon escul... 88 2e-016 >gi|33340591|gb|AAQ14866.1|AF329450_1 transcription factor BZIP1 [Catharanthus roseus] Length = 437 Score = 105 bits (261), Expect = 1e-021 Identities = 50/60 (83%), Positives = 58/60 (96%) Frame = +1 Query: 1 RSRARKQAYTLELEAEVAKLKEMNEELQRKQAEIVEMQKDEILETMQRKWGGKRQCLRRT 180 RSRARKQAYTLELEAEVAKLKE+NEELQRKQAE++EMQK+++LETM+ WGGKR+CLRRT Sbjct: 373 RSRARKQAYTLELEAEVAKLKEINEELQRKQAELMEMQKNQMLETMEMPWGGKRRCLRRT 432 >gi|18402186|ref|NP_566629.1| ABF4 (ABRE BINDING FACTOR 4); DNA binding / transcription activator/ transcription factor [Arabidopsis thaliana] Length = 431 Score = 97 bits (240), Expect = 3e-019 Identities = 46/60 (76%), Positives = 54/60 (90%) Frame = +1 Query: 1 RSRARKQAYTLELEAEVAKLKEMNEELQRKQAEIVEMQKDEILETMQRKWGGKRQCLRRT 180 RSRARKQAYTLELEAE+ KLK+ N+ELQ+KQAE+VEMQK+E+ ET +R WG KRQCLRRT Sbjct: 367 RSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQKNELKETSKRPWGSKRQCLRRT 426 >gi|94503774|gb|ABF29696.1| abscisic acid responsive element-binding protein 2 [Populus suaveolens] Length = 406 Score = 91 bits (225), Expect = 2e-017 Identities = 44/60 (73%), Positives = 54/60 (90%) Frame = +1 Query: 1 RSRARKQAYTLELEAEVAKLKEMNEELQRKQAEIVEMQKDEILETMQRKWGGKRQCLRRT 180 RSRARKQAYT+ELEAEVAKLK NEELQ+KQAE++EMQK++++E M + GGKR+CLRRT Sbjct: 342 RSRARKQAYTMELEAEVAKLKAENEELQKKQAEMMEMQKNQVMEMMTLQQGGKRRCLRRT 401 >gi|67906424|gb|AAY82589.1| bZIP [Nicotiana tabacum] Length = 400 Score = 90 bits (222), Expect = 4e-017 Identities = 42/60 (70%), Positives = 51/60 (85%) Frame = +1 Query: 1 RSRARKQAYTLELEAEVAKLKEMNEELQRKQAEIVEMQKDEILETMQRKWGGKRQCLRRT 180 RSRARKQAYTLELEAEV KLKE+N+EL +KQAE +EMQK++++E M WG K +CLRRT Sbjct: 336 RSRARKQAYTLELEAEVEKLKEINKELHKKQAEFIEMQKNQLMEKMNMPWGNKLRCLRRT 395 >gi|42561991|gb|AAS20434.1| AREB-like protein [Lycopersicon esculentum] Length = 447 Score = 88 bits (217), Expect = 2e-016 Identities = 42/60 (70%), Positives = 53/60 (88%) Frame = +1 Query: 1 RSRARKQAYTLELEAEVAKLKEMNEELQRKQAEIVEMQKDEILETMQRKWGGKRQCLRRT 180 RSRARKQAYT+ELEAEVAKLKE N+ELQ+KQ E++EMQK++++E M + G KR+CLRRT Sbjct: 383 RSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEMQKNQVIEMMNLQKGAKRRCLRRT 442 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,734,349,300 Number of Sequences: 7387702 Number of Extensions: 86734349300 Number of Successful Extensions: 36856267 Number of sequences better than 0.0: 0 |