BLASTX 7.6.2 Query= RU40574 /QuerySize=212 (211 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|154331689|ref|XP_001561662.1| hypothetical protein [Leishmani... 55 1e-006 gi|156103858|gb|ABU49049.1| pleiomorphic adenoma protein-like 2 ... 53 5e-006 gi|47224393|emb|CAG08643.1| unnamed protein product [Tetraodon n... 53 7e-006 >gi|154331689|ref|XP_001561662.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] Length = 1295 Score = 55 bits (131), Expect = 1e-006 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 130 GRTWWWWQLKWWWWWWWGWW 189 G W WW+ +WWWWWWW WW Sbjct: 1263 GGRWRWWRWRWWWWWWWRWW 1282 >gi|156103858|gb|ABU49049.1| pleiomorphic adenoma protein-like 2 [Diodon hystrix] Length = 269 Score = 53 bits (126), Expect = 5e-006 Identities = 23/44 (52%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -3 Query: 191 HHHPHHHHHHHFNCHHHHVRPNFTSFAQNP---EQATPVPFPTY 69 HHHPHHHHHHH + HHHH P Q P +Q P P P Y Sbjct: 225 HHHPHHHHHHHHH-HHHHHSPPLPPHHQPPAPQQQHQPQPAPKY 267 >gi|47224393|emb|CAG08643.1| unnamed protein product [Tetraodon nigroviridis] Length = 307 Score = 53 bits (125), Expect = 7e-006 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -2 Query: 210 PLIPQTSPPPPPPPPPPLQLPPPPCSPQFHIFCSKPRTSYSRSFPNL 70 PL P PPPPPPPPPP PPPP SP +F P S SFP L Sbjct: 183 PLFPLFPPPPPPPPPPPFS-PPPPPSPPPSLFSPPPFFSPPPSFPPL 228 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,734,349,300 Number of Sequences: 7387702 Number of Extensions: 86734349300 Number of Successful Extensions: 36856267 Number of sequences better than 0.0: 0 |