BLASTX 7.6.2 Query= RU43444 /QuerySize=162 (161 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|22095656|sp|O81122.1|ETR1_MALDO RecName: Full=Ethylene receptor 90 4e-017 gi|14572558|gb|AAK64658.1| ethylene receptor [Malus x domestica] 90 4e-017 gi|18252341|gb|AAL66202.1|AF386520_1 putative ethylene receptor ... 90 4e-017 gi|154000881|gb|ABS57008.1| ethylene receptor [Pyrus pyrifolia] 90 4e-017 gi|15131529|emb|CAC48384.1| ethylene receptor [Fragaria x ananassa] 87 3e-016 >gi|22095656|sp|O81122.1|ETR1_MALDO RecName: Full=Ethylene receptor Length = 741 Score = 90 bits (222), Expect = 4e-017 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 2 SVTLNLAADLPVYAIGDEKRLMQTILNVVGNAVKFSKEGSIWITVFVAKS 151 SVTLN+AADLP+YAIGDEKRLMQTILNVVGNAVKFSKEGSI IT FVAKS Sbjct: 440 SVTLNIAADLPMYAIGDEKRLMQTILNVVGNAVKFSKEGSISITAFVAKS 489 >gi|14572558|gb|AAK64658.1| ethylene receptor [Malus x domestica] Length = 570 Score = 90 bits (222), Expect = 4e-017 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 2 SVTLNLAADLPVYAIGDEKRLMQTILNVVGNAVKFSKEGSIWITVFVAKS 151 SVTLN+AADLP+YAIGDEKRLMQTILNVVGNAVKFSKEGSI IT FVAKS Sbjct: 269 SVTLNIAADLPMYAIGDEKRLMQTILNVVGNAVKFSKEGSISITAFVAKS 318 >gi|18252341|gb|AAL66202.1|AF386520_1 putative ethylene receptor [Pyrus communis] Length = 741 Score = 90 bits (222), Expect = 4e-017 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 2 SVTLNLAADLPVYAIGDEKRLMQTILNVVGNAVKFSKEGSIWITVFVAKS 151 SVTLN+AADLP+YAIGDEKRLMQTILNVVGNAVKFSKEGSI IT FVAKS Sbjct: 440 SVTLNIAADLPMYAIGDEKRLMQTILNVVGNAVKFSKEGSISITAFVAKS 489 >gi|154000881|gb|ABS57008.1| ethylene receptor [Pyrus pyrifolia] Length = 741 Score = 90 bits (222), Expect = 4e-017 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +2 Query: 2 SVTLNLAADLPVYAIGDEKRLMQTILNVVGNAVKFSKEGSIWITVFVAKS 151 SVTLN+AADLP+YAIGDEKRLMQTILNVVGNAVKFSKEGSI IT FVAKS Sbjct: 440 SVTLNIAADLPMYAIGDEKRLMQTILNVVGNAVKFSKEGSISITAFVAKS 489 >gi|15131529|emb|CAC48384.1| ethylene receptor [Fragaria x ananassa] Length = 741 Score = 87 bits (215), Expect = 3e-016 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +2 Query: 2 SVTLNLAADLPVYAIGDEKRLMQTILNVVGNAVKFSKEGSIWITVFVAKS 151 SVTLNLAADLPVYAIGDE+RL+Q ILNVVGNAVKFSKEGSI IT FVAKS Sbjct: 440 SVTLNLAADLPVYAIGDERRLLQIILNVVGNAVKFSKEGSISITAFVAKS 489 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,734,349,300 Number of Sequences: 7387702 Number of Extensions: 86734349300 Number of Successful Extensions: 36856267 Number of sequences better than 0.0: 0 |