BLASTX 7.6.2 Query= RU44221 /QuerySize=331 (330 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157335908|emb|CAO61738.1| unnamed protein product [Vitis vini... 77 4e-013 gi|115458730|ref|NP_001052965.1| Os04g0455900 [Oryza sativa (jap... 76 7e-013 gi|125548542|gb|EAY94364.1| hypothetical protein OsI_015597 [Ory... 76 7e-013 gi|125590594|gb|EAZ30944.1| hypothetical protein OsJ_014427 [Ory... 76 7e-013 gi|194696974|gb|ACF82571.1| unknown [Zea mays] 75 1e-012 >gi|157335908|emb|CAO61738.1| unnamed protein product [Vitis vinifera] Length = 386 Score = 77 bits (187), Expect = 4e-013 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 198 MENMMSRLRNLDAYPKINEDFYSRTLSGGVITLVSSIVMLLLFL 329 M+N++++LRNLDAYPKINEDFYSRTLSGGVITL SSI MLLLF+ Sbjct: 1 MDNIINKLRNLDAYPKINEDFYSRTLSGGVITLASSIFMLLLFI 44 >gi|115458730|ref|NP_001052965.1| Os04g0455900 [Oryza sativa (japonica cultivar-group)] Length = 386 Score = 76 bits (185), Expect = 7e-013 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +3 Query: 198 MENMMSRLRNLDAYPKINEDFYSRTLSGGVITLVSSIVMLLLFL 329 ME ++S+LR+LDAYPK+NEDFYSRTLSGG+ITL SS+VMLLLF+ Sbjct: 1 MEGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFV 44 >gi|125548542|gb|EAY94364.1| hypothetical protein OsI_015597 [Oryza sativa (indica cultivar-group)] Length = 376 Score = 76 bits (185), Expect = 7e-013 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +3 Query: 198 MENMMSRLRNLDAYPKINEDFYSRTLSGGVITLVSSIVMLLLFL 329 ME ++S+LR+LDAYPK+NEDFYSRTLSGG+ITL SS+VMLLLF+ Sbjct: 1 MEGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFV 44 >gi|125590594|gb|EAZ30944.1| hypothetical protein OsJ_014427 [Oryza sativa (japonica cultivar-group)] Length = 349 Score = 76 bits (185), Expect = 7e-013 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +3 Query: 198 MENMMSRLRNLDAYPKINEDFYSRTLSGGVITLVSSIVMLLLFL 329 ME ++S+LR+LDAYPK+NEDFYSRTLSGG+ITL SS+VMLLLF+ Sbjct: 1 MEGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFV 44 >gi|194696974|gb|ACF82571.1| unknown [Zea mays] Length = 386 Score = 75 bits (182), Expect = 1e-012 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +3 Query: 198 MENMMSRLRNLDAYPKINEDFYSRTLSGGVITLVSSIVMLLLFL 329 M+ ++S+LR+LDAYPK+NEDFYSRTLSGG+ITLVSS VMLLLF+ Sbjct: 1 MDGLLSKLRSLDAYPKVNEDFYSRTLSGGIITLVSSAVMLLLFV 44 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 126,048,254,341 Number of Sequences: 7387702 Number of Extensions: 126048254341 Number of Successful Extensions: 46626747 Number of sequences better than 0.0: 0 |