BLASTX 7.6.2 Query= RU44252 /QuerySize=366 (365 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|71665641|ref|XP_819788.1| formin [Trypanosoma cruzi strain CL... 61 2e-008 gi|116193561|ref|XP_001222593.1| predicted protein [Chaetomium g... 60 4e-008 gi|75905721|gb|ABA29253.1| RL2 [Cercopithecine herpesvirus 16] 57 3e-007 gi|110224438|ref|YP_443846.2| ubiquitin E3 ligase ICP0 [Papiine ... 57 3e-007 gi|67620430|ref|XP_667700.1| protease [Cryptosporidium hominis T... 56 5e-007 >gi|71665641|ref|XP_819788.1| formin [Trypanosoma cruzi strain CL Brener] Length = 968 Score = 61 bits (147), Expect = 2e-008 Identities = 26/60 (43%), Positives = 34/60 (56%) Frame = +3 Query: 60 LSNGISIFSPQTHFRPSQVPKPLPPQTSSSSKPTSDPPPPPPASSRSAPTSATTPPPPPP 239 L+ +S+ P H+ PS +P P SSS P + PPPPPP ++AP PPPPPP Sbjct: 436 LALSLSVPQPAHHYDPSSIPTNQPVSPSSSPPPRTPPPPPPPPPGKNAPPPPPPPPPPPP 495 >gi|116193561|ref|XP_001222593.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 205 Score = 60 bits (144), Expect = 4e-008 Identities = 29/78 (37%), Positives = 39/78 (50%) Frame = +3 Query: 87 PQTHFRPSQVPKPLPPQTSSSSKPTSDPPPPPPASSRSAPTSATTPPPPPPTRPTPQLSS 266 P T P P P P T+ P PPPPP +S++SA PPPPPP P P ++S Sbjct: 111 PPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPPPPPVVTS 170 Query: 267 HQLRSFSATAITTRNSGS 320 S TA+ ++ + S Sbjct: 171 PPTLSVGTTALPSKTATS 188 >gi|75905721|gb|ABA29253.1| RL2 [Cercopithecine herpesvirus 16] Length = 573 Score = 57 bits (136), Expect = 3e-007 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +3 Query: 105 PSQVPKPLPPQTSSSSKPTSDPPPPPPASSRSAPTSATTPPPPPPTRPTP 254 P P+P P ++++ P PPPPPP +SR+ +A PPPPPP P P Sbjct: 348 PRDAPRPQAPPLAAAAPPPPAPPPPPPPASRAPRGAAAAPPPPPPAAPPP 397 >gi|110224438|ref|YP_443846.2| ubiquitin E3 ligase ICP0 [Papiine herpesvirus 2] Length = 713 Score = 57 bits (136), Expect = 3e-007 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +3 Query: 105 PSQVPKPLPPQTSSSSKPTSDPPPPPPASSRSAPTSATTPPPPPPTRPTP 254 P P+P P ++++ P PPPPPP +SR+ +A PPPPPP P P Sbjct: 488 PRDAPRPQAPPLAAAAPPPPAPPPPPPPASRAPRGAAAAPPPPPPAAPPP 537 >gi|67620430|ref|XP_667700.1| protease [Cryptosporidium hominis TU502] Length = 1569 Score = 56 bits (134), Expect = 5e-007 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +3 Query: 123 PLPPQTSSSSKPTSDPPPPPPASSRSAPTSATTPPPPPPTRPTP 254 PLPP +SSS P PPPPPP S S+P+ PPP PP P P Sbjct: 1523 PLPPPSSSSPSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPPPP 1566 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 126,048,254,341 Number of Sequences: 7387702 Number of Extensions: 126048254341 Number of Successful Extensions: 46626747 Number of sequences better than 0.0: 0 |