BLASTX 7.6.2 Query= RU50493 /QuerySize=205 (204 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157338926|emb|CAO42277.1| unnamed protein product [Vitis vini... 60 6e-008 >gi|157338926|emb|CAO42277.1| unnamed protein product [Vitis vinifera] Length = 439 Score = 60 bits (143), Expect = 6e-008 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 68 HHRRLSSPNKPLPTRSGYLPVNPTTNSAIYYTFYEATKPQSHLS 199 H + + PLPT+SGYLPVNPTTNSA++YTFYEA P S L+ Sbjct: 23 HTKSPPASTLPLPTKSGYLPVNPTTNSAMFYTFYEAQNPISPLT 66 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 182,525,785,157 Number of Sequences: 7387702 Number of Extensions: 182525785157 Number of Successful Extensions: 82043520 Number of sequences better than 0.0: 0 |