BLASTX 7.6.2 Query= RU52089 /QuerySize=187 (186 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147841694|emb|CAN68658.1| hypothetical protein [Vitis vinifera] 82 1e-014 gi|157347488|emb|CAO18125.1| unnamed protein product [Vitis vini... 82 1e-014 gi|15242640|ref|NP_195931.1| unknown protein [Arabidopsis thaliana] 57 5e-007 >gi|147841694|emb|CAN68658.1| hypothetical protein [Vitis vinifera] Length = 743 Score = 82 bits (201), Expect = 1e-014 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +3 Query: 3 EEEEEEPEFERKAKAFAASSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPDRAKEETGE 182 E+ ++ E +A+ F +SSFSPPKNALLLTRCRSAPYRSSSLASRFWGSP +EE Sbjct: 575 EQSDDVGNEEEEARVFYSSSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPLATEEEQKT 634 Query: 183 E 185 E Sbjct: 635 E 635 >gi|157347488|emb|CAO18125.1| unnamed protein product [Vitis vinifera] Length = 320 Score = 82 bits (201), Expect = 1e-014 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +3 Query: 3 EEEEEEPEFERKAKAFAASSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPDRAKEETGE 182 E+ ++ E +A+ F +SSFSPPKNALLLTRCRSAPYRSSSLASRFWGSP +EE Sbjct: 151 EQSDDVGNEEEEARVFYSSSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPLATEEEQKT 210 Query: 183 E 185 E Sbjct: 211 E 211 >gi|15242640|ref|NP_195931.1| unknown protein [Arabidopsis thaliana] Length = 283 Score = 57 bits (135), Expect = 5e-007 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = +3 Query: 3 EEEEEEPEFERKAKAFAASSFSPPKNALLLTRCRSAPYRSSSLASRFWGSPDRAKEET 176 EE E E FE K F + + +PP NALLLTR RSAPYRSSSLA RFW ++ + E+ Sbjct: 158 EEIEGEENFE-IPKLFVSPATTPPINALLLTRSRSAPYRSSSLAFRFWEENNQREVES 214 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 182,525,785,157 Number of Sequences: 7387702 Number of Extensions: 182525785157 Number of Successful Extensions: 82043520 Number of sequences better than 0.0: 0 |