BLASTX 7.6.2 Query= RU55207 /QuerySize=247 (246 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157357293|emb|CAO63801.1| unnamed protein product [Vitis vini... 62 1e-008 gi|147833136|emb|CAN75299.1| hypothetical protein [Vitis vinifera] 58 2e-007 gi|15230141|ref|NP_189109.1| TMKL1 (TRANSMEMBRANE KINASE-LIKE 1)... 56 6e-007 >gi|157357293|emb|CAO63801.1| unnamed protein product [Vitis vinifera] Length = 675 Score = 62 bits (148), Expect = 1e-008 Identities = 32/58 (55%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +1 Query: 73 LFCFLLYFILCFNVLPTWSSSSSSSSDVELLLGNIKASLQGN-AQNLLLTSWNTSLPV 243 +F F + + +++ + SSSSSSSSDVELLL IK SLQG+ + NLLL+SWNTS+P+ Sbjct: 9 VFFFFFFIVSSISLIDSPSSSSSSSSDVELLLNKIKPSLQGSYSDNLLLSSWNTSVPL 66 >gi|147833136|emb|CAN75299.1| hypothetical protein [Vitis vinifera] Length = 628 Score = 58 bits (139), Expect = 2e-007 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 7/70 (10%) Frame = +1 Query: 55 MEILKPLFCFLLYFILCFNV------LPTWSSSSSSSSDVELLLGNIKASLQGN-AQNLL 213 ME+ F F +F + ++ + SSSSSSSSDVELLL IK SLQG+ + NLL Sbjct: 1 MELQLFFFVFFFFFFIVSSISLIDSPSSSSSSSSSSSSDVELLLNKIKPSLQGSYSDNLL 60 Query: 214 LTSWNTSLPV 243 L+SWNTS+P+ Sbjct: 61 LSSWNTSVPL 70 >gi|15230141|ref|NP_189109.1| TMKL1 (TRANSMEMBRANE KINASE-LIKE 1); ATP binding / kinase/ protein serine/threonine kinase [Arabidopsis thaliana] Length = 674 Score = 56 bits (134), Expect = 6e-007 Identities = 26/38 (68%), Positives = 35/38 (92%) Frame = +1 Query: 130 SSSSSSSDVELLLGNIKASLQGNAQNLLLTSWNTSLPV 243 +S S SSDV+LLLG IK+SLQGN+++LLL+SWN+S+PV Sbjct: 25 TSLSGSSDVKLLLGKIKSSLQGNSESLLLSSWNSSVPV 62 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 219,884,949,690 Number of Sequences: 7387702 Number of Extensions: 219884949690 Number of Successful Extensions: 91935933 Number of sequences better than 0.0: 0 |