BLASTX 7.6.2 Query= RU56432 /QuerySize=182 (181 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147809572|emb|CAN62390.1| hypothetical protein [Vitis vinifera] 56 9e-007 >gi|147809572|emb|CAN62390.1| hypothetical protein [Vitis vinifera] Length = 696 Score = 56 bits (133), Expect = 9e-007 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 5/58 (8%) Frame = +1 Query: 7 KQFLISSYKKNLYPALKAEIQQSQKDPAVLSSSSSSRTSSSRGSRDYEWTTSWWEQFK 180 KQ LISSYKK+LY ++AEI ++ S S+S SSRG + +WT+SWWEQFK Sbjct: 383 KQALISSYKKSLYHIMRAEIHRNSHG----SDGSASGPLSSRGCEN-QWTSSWWEQFK 435 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 219,884,949,690 Number of Sequences: 7387702 Number of Extensions: 219884949690 Number of Successful Extensions: 91935933 Number of sequences better than 0.0: 0 |