BLASTX 7.6.2 Query= RU57030 /QuerySize=197 (196 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157346840|emb|CAO17079.1| unnamed protein product [Vitis vini... 59 1e-007 >gi|157346840|emb|CAO17079.1| unnamed protein product [Vitis vinifera] Length = 392 Score = 59 bits (141), Expect = 1e-007 Identities = 36/56 (64%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 27 SSSLMLRRFLCFNASPPSSSSSSILCFSSSRNRKPLVFLGSPQVSATVLDALLNAS 194 +SSLMLRRF NA+ SSSS S S+ RK LVFLGSPQVSA VLD L NAS Sbjct: 29 NSSLMLRRFFTLNATSSSSSSCSASLKPPSK-RKQLVFLGSPQVSAAVLDDLFNAS 83 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 226,260,899,309 Number of Sequences: 7387702 Number of Extensions: 226260899309 Number of Successful Extensions: 100383492 Number of sequences better than 0.0: 0 |