BLASTX 7.6.2 Query= RU58118 /QuerySize=266 (265 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157336333|emb|CAO71018.1| unnamed protein product [Vitis vini... 65 1e-009 gi|89475530|gb|ABD73297.1| unknown [Panax ginseng] 64 4e-009 gi|13265596|gb|AAG40073.2|AF324722_1 AT4g15610 [Arabidopsis thal... 57 5e-007 gi|18414489|ref|NP_567472.1| integral membrane family protein [A... 57 5e-007 gi|124484393|dbj|BAF46307.1| integral membrane family protein [I... 54 4e-006 >gi|157336333|emb|CAO71018.1| unnamed protein product [Vitis vinifera] Length = 148 Score = 65 bits (157), Expect = 1e-009 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = +1 Query: 76 KVCSIFDKYCKHLAGSLATSLFASVLLVLLVWLSTFSLHKKIPK 207 KVC+ +DK+C+H+ GS+A +LFAS+LLVLLVWLS F+L+ +I K Sbjct: 105 KVCNTYDKFCRHVGGSIAVALFASILLVLLVWLSLFTLYSRIRK 148 >gi|89475530|gb|ABD73297.1| unknown [Panax ginseng] Length = 148 Score = 64 bits (153), Expect = 4e-009 Identities = 29/53 (54%), Positives = 40/53 (75%) Frame = +1 Query: 49 RNNLDK*ETKVCSIFDKYCKHLAGSLATSLFASVLLVLLVWLSTFSLHKKIPK 207 R N TK+C+I+D +C+HLAGS+A L AS++LVLL+ LS F+L +KIPK Sbjct: 96 RGNSHSRWTKICNIYDTFCQHLAGSIAAGLIASIVLVLLILLSFFTLSRKIPK 148 >gi|13265596|gb|AAG40073.2|AF324722_1 AT4g15610 [Arabidopsis thaliana] Length = 146 Score = 57 bits (135), Expect = 5e-007 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +1 Query: 76 KVCSIFDKYCKHLAGSLATSLFASVLLVLLVWLSTFSLHKKI 201 K+C I+DK+C+H+ G++A SLFASV+L+LL +S SL+KKI Sbjct: 104 KICHIYDKFCRHVGGAIAVSLFASVVLLLLSIISVLSLYKKI 145 >gi|18414489|ref|NP_567472.1| integral membrane family protein [Arabidopsis thaliana] Length = 193 Score = 57 bits (135), Expect = 5e-007 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +1 Query: 76 KVCSIFDKYCKHLAGSLATSLFASVLLVLLVWLSTFSLHKKI 201 K+C I+DK+C+H+ G++A SLFASV+L+LL +S SL+KKI Sbjct: 151 KICHIYDKFCRHVGGAIAVSLFASVVLLLLSIISVLSLYKKI 192 >gi|124484393|dbj|BAF46307.1| integral membrane family protein [Ipomoea nil] Length = 152 Score = 54 bits (127), Expect = 4e-006 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +1 Query: 73 TKVCSIFDKYCKHLAGSLATSLFASVLLVLLVWLSTFSLHKKIPK 207 TKVC+ + K C HL SLA S FA ++L+LL+ LS SL KKIPK Sbjct: 108 TKVCNKYGKLCTHLGASLAVSFFAFIVLLLLIILSIHSLSKKIPK 152 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 238,745,819,074 Number of Sequences: 7387702 Number of Extensions: 238745819074 Number of Successful Extensions: 117197602 Number of sequences better than 0.0: 0 |