BLASTX 7.6.2 Query= RU59786 /QuerySize=291 (290 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157349251|emb|CAO24397.1| unnamed protein product [Vitis vini... 66 6e-010 gi|66820991|ref|XP_644032.1| hypothetical protein [Dictyostelium... 59 7e-008 gi|66801559|ref|XP_629705.1| hypothetical protein [Dictyostelium... 57 4e-007 gi|47197775|emb|CAF88611.1| unnamed protein product [Tetraodon n... 55 1e-006 >gi|157349251|emb|CAO24397.1| unnamed protein product [Vitis vinifera] Length = 651 Score = 66 bits (160), Expect = 6e-010 Identities = 36/53 (67%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +1 Query: 10 QPSRASQISKEEELKRALVAEREKRAAAAERRMAAAAALSAQGSEGGDGGCGY 168 QP +S IS+EEELKRA AEREKRAAAAERR+AAAA+L+AQG D C Y Sbjct: 566 QPQSSSTISREEELKRAATAEREKRAAAAERRIAAAASLNAQG-PASDINCSY 617 >gi|66820991|ref|XP_644032.1| hypothetical protein [Dictyostelium discoideum AX4] Length = 233 Score = 59 bits (142), Expect = 7e-008 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 235 H*HHHHHHPHHPWYHRH*HHLDHSHSHHRH 146 H HHHHHHPHHP +H H HH H H HH H Sbjct: 89 HHHHHHHHPHHPHHHPHHHHHPHHHHHHHH 118 >gi|66801559|ref|XP_629705.1| hypothetical protein [Dictyostelium discoideum AX4] Length = 354 Score = 57 bits (135), Expect = 4e-007 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = -2 Query: 235 H*HHHHHHPHHPWYHRH*HHLDHSHSHHRHLQIL 134 H HHHHHH HH +H H HH H H HH H +IL Sbjct: 115 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHFKIL 148 >gi|47197775|emb|CAF88611.1| unnamed protein product [Tetraodon nigroviridis] Length = 135 Score = 55 bits (131), Expect = 1e-006 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = -2 Query: 250 PSLTCH*HHHHHHPHHPWYHRH*HHLDHSHSHHRH 146 P L H HHHHHH HH +H H HH H H HH H Sbjct: 52 PPLHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 86 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 257,644,698,401 Number of Sequences: 7387702 Number of Extensions: 257644698401 Number of Successful Extensions: 141677024 Number of sequences better than 0.0: 0 |