BLASTX 7.6.2 Query= RU60301 /QuerySize=328 (327 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|18411903|ref|NP_565177.1| VQ motif-containing protein [Arabid... 57 4e-007 gi|21593131|gb|AAM65080.1| unknown [Arabidopsis thaliana] 57 4e-007 >gi|18411903|ref|NP_565177.1| VQ motif-containing protein [Arabidopsis thaliana] Length = 311 Score = 57 bits (135), Expect = 4e-007 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 229 RSTAPLSPLPPFPTVHASAESPVSAYMRFFHNS 327 R TAPLSPLPP P VHA+AESPVS+YMR+ NS Sbjct: 168 RPTAPLSPLPPLPPVHAAAESPVSSYMRYLQNS 200 >gi|21593131|gb|AAM65080.1| unknown [Arabidopsis thaliana] Length = 311 Score = 57 bits (135), Expect = 4e-007 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 229 RSTAPLSPLPPFPTVHASAESPVSAYMRFFHNS 327 R TAPLSPLPP P VHA+AESPVS+YMR+ NS Sbjct: 168 RPTAPLSPLPPLPPVHAAAESPVSSYMRYLQNS 200 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 257,644,698,401 Number of Sequences: 7387702 Number of Extensions: 257644698401 Number of Successful Extensions: 141677024 Number of sequences better than 0.0: 0 |