BLASTX 7.6.2 Query= RU60366 /QuerySize=301 (300 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|61661400|gb|AAX51291.1| MYB5b [Vitis vinifera] 113 4e-024 gi|157337728|emb|CAO22074.1| unnamed protein product [Vitis vini... 113 4e-024 gi|45593281|gb|AAS68190.1| Myb transcription factor [Vitis vinif... 109 7e-023 gi|157348574|emb|CAO23466.1| unnamed protein product [Vitis vini... 109 7e-023 gi|145306603|gb|ABP57069.1| Myb-like protein P [Fagopyrum cymosum] 104 3e-021 >gi|61661400|gb|AAX51291.1| MYB5b [Vitis vinifera] Length = 311 Score = 113 bits (282), Expect = 4e-024 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +1 Query: 124 APKTAAVSSSSSKTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRC 300 A +A SSSSKTPCC+KVGLKRGPWTPEEDE+LANYIKKEGEGRWRTLPKRAGLLRC Sbjct: 4 ASSASAPPSSSSKTPCCIKVGLKRGPWTPEEDEVLANYIKKEGEGRWRTLPKRAGLLRC 62 >gi|157337728|emb|CAO22074.1| unnamed protein product [Vitis vinifera] Length = 312 Score = 113 bits (282), Expect = 4e-024 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = +1 Query: 124 APKTAAVSSSSSKTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRC 300 A +A SSSSKTPCC+KVGLKRGPWTPEEDE+LANYIKKEGEGRWRTLPKRAGLLRC Sbjct: 4 ASSASAPPSSSSKTPCCIKVGLKRGPWTPEEDEVLANYIKKEGEGRWRTLPKRAGLLRC 62 >gi|45593281|gb|AAS68190.1| Myb transcription factor [Vitis vinifera] Length = 320 Score = 109 bits (271), Expect = 7e-023 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +1 Query: 145 SSSSSKTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRC 300 S+S+SKTPCC KVGLKRGPWTPEEDELLANY+K+EGEGRWRTLPKRAGLLRC Sbjct: 6 SASTSKTPCCTKVGLKRGPWTPEEDELLANYVKREGEGRWRTLPKRAGLLRC 57 >gi|157348574|emb|CAO23466.1| unnamed protein product [Vitis vinifera] Length = 320 Score = 109 bits (271), Expect = 7e-023 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +1 Query: 145 SSSSSKTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRC 300 S+S+SKTPCC KVGLKRGPWTPEEDELLANY+K+EGEGRWRTLPKRAGLLRC Sbjct: 6 SASTSKTPCCTKVGLKRGPWTPEEDELLANYVKREGEGRWRTLPKRAGLLRC 57 >gi|145306603|gb|ABP57069.1| Myb-like protein P [Fagopyrum cymosum] Length = 265 Score = 104 bits (257), Expect = 3e-021 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = +1 Query: 130 KTAAVSSSSSKTPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRC 300 + AVSS + TPCC KVGLKRGPWTPEEDE LANYI K+GEGRWRTLPKRAGLLRC Sbjct: 2 RNPAVSSGAKTTPCCSKVGLKRGPWTPEEDERLANYINKDGEGRWRTLPKRAGLLRC 58 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 264,287,004,385 Number of Sequences: 7387702 Number of Extensions: 264287004385 Number of Successful Extensions: 149960990 Number of sequences better than 0.0: 0 |