BLASTX 7.6.2 Query= RU00016 /QuerySize=946 (945 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8TGM7|ART2_YEAST Uncharacterized protein ART2 OS=Saccharomyc... 55 6e-007 sp|Q3E811|YL62A_YEAST Uncharacterized protein YLR162W-A OS=Sacch... 55 8e-007 >sp|Q8TGM7|ART2_YEAST Uncharacterized protein ART2 OS=Saccharomyces cerevisiae GN=ART2 PE=2 SV=1 Length = 61 Score = 55 bits (131), Expect = 6e-007 Identities = 32/57 (56%) Frame = +2 Query: 572 VRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPAPAKLPT*QCLPPGSAR 742 V I T NQNQ FYPFV EISVL E LGHLRY LTDVP P P R Sbjct: 2 VCIHTENQNQGGFYPFVLLEISVLHEPPLGHLRYRLTDVPPQPNSPPDNVFNPDQPR 58 >sp|Q3E811|YL62A_YEAST Uncharacterized protein YLR162W-A OS=Saccharomyces cerevisiae GN=YLR162W-A PE=2 SV=1 Length = 62 Score = 55 bits (130), Expect = 8e-007 Identities = 30/46 (65%) Frame = +2 Query: 572 VRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPAPAKLP 709 V I T NQNQ FYPFV EISVL E LGHLRY LTDVP P Sbjct: 2 VCIHTENQNQGDFYPFVLLEISVLHESPLGHLRYRLTDVPPQPNSP 47 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 350,678,508 Number of Sequences: 462764 Number of Extensions: 350678508 Number of Successful Extensions: 6166835 Number of sequences better than 0.0: 0 |