BLASTX 7.6.2 Query= RU01101 /QuerySize=909 (908 letters) Database: UniProt/Swiss-Prot; 462,764 sequences; 163,773,382 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protei... 54 1e-006 >sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=2 SV=1 Length = 559 Score = 54 bits (128), Expect = 1e-006 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 6/87 (6%) Frame = +1 Query: 79 INGYWKLCDIDVACLEMNMIRVGG---CRPDFVTFNTLFNGFCKVEVRREVFAYMGLM-- 243 I+G+ + DI A L + +R C+PD V+FN+LFNGF K+++ EVF YMG+M Sbjct: 98 IDGHCRNGDIRSASLVLESLRASHGFICKPDIVSFNSLFNGFSKMKMLDEVFVYMGVMLK 157 Query: 244 -CRRIFWLLLL*LMGICKVGNLKIAIR 321 C + CK G L++A++ Sbjct: 158 CCSPNVVTYSTWIDTFCKSGELQLALK 184 Database: UniProt/Swiss-Prot Posted date: Thu Apr 23 14:22:33 2009 Number of letters in database: 163,773,382 Number of sequences in database: 462,764 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,055,803,260 Number of Sequences: 462764 Number of Extensions: 3055803260 Number of Successful Extensions: 28798457 Number of sequences better than 0.0: 0 |